BLASTX nr result
ID: Panax21_contig00029254
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00029254 (840 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002329197.1| predicted protein [Populus trichocarpa] gi|2... 77 6e-12 gb|AAN63619.1|AF435818_1 thioredoxin h-like protein [Nicotiana t... 75 2e-11 ref|NP_191201.4| putative thioredoxin H10 [Arabidopsis thaliana]... 74 3e-11 gb|AAD49233.1|AF159388_1 thioredoxin-like protein [Phalaris coer... 74 4e-11 ref|XP_003568845.1| PREDICTED: thioredoxin H4-2-like [Brachypodi... 74 4e-11 >ref|XP_002329197.1| predicted protein [Populus trichocarpa] gi|222870978|gb|EEF08109.1| predicted protein [Populus trichocarpa] Length = 127 Score = 76.6 bits (187), Expect = 6e-12 Identities = 32/49 (65%), Positives = 40/49 (81%) Frame = -3 Query: 520 KWEEKLSEANRDNKIVVVNFSASWCTPCRVISPAFADLADKYSSMMFLT 374 KW EK+SEA+RD KI +VNFSA WC PC+ + AF +LADKYSS++FLT Sbjct: 29 KWNEKISEASRDGKIAIVNFSALWCAPCKTTAQAFCELADKYSSVIFLT 77 >gb|AAN63619.1|AF435818_1 thioredoxin h-like protein [Nicotiana tabacum] Length = 152 Score = 74.7 bits (182), Expect = 2e-11 Identities = 29/48 (60%), Positives = 42/48 (87%) Frame = -3 Query: 517 WEEKLSEANRDNKIVVVNFSASWCTPCRVISPAFADLADKYSSMMFLT 374 W++KL+EAN++ KIV+ NFSASWC PCR+I+P + +L++KY S+MFLT Sbjct: 45 WDQKLAEANKEGKIVIANFSASWCGPCRMIAPFYCELSEKYLSLMFLT 92 >ref|NP_191201.4| putative thioredoxin H10 [Arabidopsis thaliana] gi|298352668|sp|Q9LXZ8.2|TRH10_ARATH RecName: Full=Putative thioredoxin H10; Short=AtTrxh10 gi|332645999|gb|AEE79520.1| putative thioredoxin H10 [Arabidopsis thaliana] Length = 154 Score = 74.3 bits (181), Expect = 3e-11 Identities = 31/49 (63%), Positives = 38/49 (77%) Frame = -3 Query: 520 KWEEKLSEANRDNKIVVVNFSASWCTPCRVISPAFADLADKYSSMMFLT 374 KWEEK++EAN KI+VVNFSA WC PC+ I P F DLA +Y SM+F+T Sbjct: 50 KWEEKITEANNHGKILVVNFSAPWCVPCKKIEPVFRDLASRYPSMIFVT 98 >gb|AAD49233.1|AF159388_1 thioredoxin-like protein [Phalaris coerulescens] gi|5732707|gb|AAD49234.1|AF159389_1 thioredoxin-like protein [Phalaris coerulescens] Length = 131 Score = 73.9 bits (180), Expect = 4e-11 Identities = 29/48 (60%), Positives = 40/48 (83%) Frame = -3 Query: 517 WEEKLSEANRDNKIVVVNFSASWCTPCRVISPAFADLADKYSSMMFLT 374 W++K++EAN+D KIVV NFSASWC PCRVI+P +A+++ Y +MFLT Sbjct: 32 WDQKIAEANKDGKIVVANFSASWCGPCRVIAPVYAEMSKTYPQLMFLT 79 >ref|XP_003568845.1| PREDICTED: thioredoxin H4-2-like [Brachypodium distachyon] Length = 131 Score = 73.9 bits (180), Expect = 4e-11 Identities = 29/49 (59%), Positives = 39/49 (79%) Frame = -3 Query: 520 KWEEKLSEANRDNKIVVVNFSASWCTPCRVISPAFADLADKYSSMMFLT 374 +W++K+ EAN+D KIVV NFSASWC PCRVI+P + D++ Y +MFLT Sbjct: 31 EWDQKIEEANKDGKIVVANFSASWCGPCRVIAPVYGDMSKAYPQLMFLT 79