BLASTX nr result
ID: Panax21_contig00029100
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00029100 (608 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_199928.1| Mitochondrial import inner membrane translocase... 62 1e-07 gb|AFJ66177.1| hypothetical protein 11M19.22 [Arabidopsis halleri] 62 1e-07 ref|XP_002864099.1| hypothetical protein ARALYDRAFT_918148 [Arab... 62 1e-07 ref|XP_002511035.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 ref|XP_002321783.1| predicted protein [Populus trichocarpa] gi|2... 59 5e-07 >ref|NP_199928.1| Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein [Arabidopsis thaliana] gi|8843851|dbj|BAA97377.1| unnamed protein product [Arabidopsis thaliana] gi|15027963|gb|AAK76512.1| unknown protein [Arabidopsis thaliana] gi|20259195|gb|AAM14313.1| unknown protein [Arabidopsis thaliana] gi|332008661|gb|AED96044.1| Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein [Arabidopsis thaliana] Length = 531 Score = 61.6 bits (148), Expect = 1e-07 Identities = 33/58 (56%), Positives = 40/58 (68%), Gaps = 5/58 (8%) Frame = +2 Query: 101 CDHADDSFVTNAIGNLCQSFLLSYGVRVGFGQPVRS-----GHCFTNRSDLGQIRATK 259 CDHAD S V NAIGNLCQSFLLSYGVRVG G +R+ G +++ DL Q+ + K Sbjct: 63 CDHADVSCVANAIGNLCQSFLLSYGVRVGIGILLRAFKLARGQSYSSLLDLKQLVSEK 120 >gb|AFJ66177.1| hypothetical protein 11M19.22 [Arabidopsis halleri] Length = 458 Score = 61.6 bits (148), Expect = 1e-07 Identities = 33/58 (56%), Positives = 40/58 (68%), Gaps = 5/58 (8%) Frame = +2 Query: 101 CDHADDSFVTNAIGNLCQSFLLSYGVRVGFGQPVRS-----GHCFTNRSDLGQIRATK 259 CDHAD S V NAIGNLCQSFLLSYGVRVG G +R+ G +++ DL Q+ + K Sbjct: 63 CDHADVSCVANAIGNLCQSFLLSYGVRVGIGILLRAFKLARGQSYSSLLDLKQLVSEK 120 >ref|XP_002864099.1| hypothetical protein ARALYDRAFT_918148 [Arabidopsis lyrata subsp. lyrata] gi|297309934|gb|EFH40358.1| hypothetical protein ARALYDRAFT_918148 [Arabidopsis lyrata subsp. lyrata] Length = 531 Score = 61.6 bits (148), Expect = 1e-07 Identities = 33/58 (56%), Positives = 40/58 (68%), Gaps = 5/58 (8%) Frame = +2 Query: 101 CDHADDSFVTNAIGNLCQSFLLSYGVRVGFGQPVRS-----GHCFTNRSDLGQIRATK 259 CDHAD S V NAIGNLCQSFLLSYGVRVG G +R+ G +++ DL Q+ + K Sbjct: 63 CDHADVSCVANAIGNLCQSFLLSYGVRVGIGILLRAFKLARGQSYSSLLDLKQLVSEK 120 >ref|XP_002511035.1| conserved hypothetical protein [Ricinus communis] gi|223550150|gb|EEF51637.1| conserved hypothetical protein [Ricinus communis] Length = 525 Score = 59.3 bits (142), Expect = 5e-07 Identities = 33/60 (55%), Positives = 42/60 (70%), Gaps = 6/60 (10%) Frame = +2 Query: 98 PCDH-ADDSFVTNAIGNLCQSFLLSYGVRVGFGQPVRS-----GHCFTNRSDLGQIRATK 259 PCDH AD+S V +AIGNLCQSFLLSYGVRVG G +R+ G +++ DL Q+ + K Sbjct: 56 PCDHPADESCVAHAIGNLCQSFLLSYGVRVGVGILLRAFKLAKGQSYSSLLDLKQLVSEK 115 >ref|XP_002321783.1| predicted protein [Populus trichocarpa] gi|222868779|gb|EEF05910.1| predicted protein [Populus trichocarpa] Length = 521 Score = 59.3 bits (142), Expect = 5e-07 Identities = 32/60 (53%), Positives = 41/60 (68%), Gaps = 6/60 (10%) Frame = +2 Query: 98 PCDHA-DDSFVTNAIGNLCQSFLLSYGVRVGFGQPVRS-----GHCFTNRSDLGQIRATK 259 PCDH D+S +AIGNLCQSFLLSYGVRVG G +R+ GH +++ DL Q+ + K Sbjct: 52 PCDHGPDESCAAHAIGNLCQSFLLSYGVRVGIGILLRAFKLAKGHSYSSILDLKQLVSEK 111