BLASTX nr result
ID: Panax21_contig00028771
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00028771 (412 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFD50362.1| pectin acetylesterase, partial [Mentha spicata] 67 1e-09 gb|AFD50361.1| pectin acetylesterase, partial [Mentha sp. MC-2012] 67 1e-09 ref|XP_002513692.1| pectin acetylesterase, putative [Ricinus com... 67 2e-09 ref|XP_002271673.1| PREDICTED: uncharacterized protein LOC100247... 66 3e-09 emb|CAN83189.1| hypothetical protein VITISV_037040 [Vitis vinifera] 66 3e-09 >gb|AFD50362.1| pectin acetylesterase, partial [Mentha spicata] Length = 144 Score = 67.0 bits (162), Expect = 1e-09 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = -2 Query: 111 GQRIWQAIILDLLPKGLSYAKKALLSGCSAGGLAVFL 1 GQRIWQAII DLLPKGLS A KALLSGCSAGGLA FL Sbjct: 3 GQRIWQAIIHDLLPKGLSQANKALLSGCSAGGLATFL 39 >gb|AFD50361.1| pectin acetylesterase, partial [Mentha sp. MC-2012] Length = 144 Score = 67.0 bits (162), Expect = 1e-09 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = -2 Query: 111 GQRIWQAIILDLLPKGLSYAKKALLSGCSAGGLAVFL 1 GQRIWQAII DLLPKGLS A KALLSGCSAGGLA FL Sbjct: 3 GQRIWQAIIHDLLPKGLSQANKALLSGCSAGGLATFL 39 >ref|XP_002513692.1| pectin acetylesterase, putative [Ricinus communis] gi|223547600|gb|EEF49095.1| pectin acetylesterase, putative [Ricinus communis] Length = 449 Score = 66.6 bits (161), Expect = 2e-09 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = -2 Query: 123 LFTGGQRIWQAIILDLLPKGLSYAKKALLSGCSAGGLAVFL 1 L+ GQRIWQAII DLLPKGL A+KALLSGCSAGGL+ FL Sbjct: 144 LYFRGQRIWQAIIRDLLPKGLGQARKALLSGCSAGGLSTFL 184 >ref|XP_002271673.1| PREDICTED: uncharacterized protein LOC100247339 [Vitis vinifera] gi|302143849|emb|CBI22710.3| unnamed protein product [Vitis vinifera] Length = 394 Score = 66.2 bits (160), Expect = 3e-09 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -2 Query: 123 LFTGGQRIWQAIILDLLPKGLSYAKKALLSGCSAGGLAVFL 1 L+ GQ+IW+AII DLLPKGLS AKKALLSGCSAGGLA FL Sbjct: 141 LYFRGQKIWRAIINDLLPKGLSKAKKALLSGCSAGGLASFL 181 >emb|CAN83189.1| hypothetical protein VITISV_037040 [Vitis vinifera] Length = 375 Score = 66.2 bits (160), Expect = 3e-09 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -2 Query: 123 LFTGGQRIWQAIILDLLPKGLSYAKKALLSGCSAGGLAVFL 1 L+ GQ+IW+AII DLLPKGLS AKKALLSGCSAGGLA FL Sbjct: 141 LYFRGQKIWRAIINDLLPKGLSKAKKALLSGCSAGGLASFL 181