BLASTX nr result
ID: Panax21_contig00028769
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00028769 (523 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002306011.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 >ref|XP_002306011.1| predicted protein [Populus trichocarpa] gi|222848975|gb|EEE86522.1| predicted protein [Populus trichocarpa] Length = 462 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 3/50 (6%) Frame = -1 Query: 523 FTDDYWARIREQTI--GYDLGVFNMEDKSIQSFYQCD-LGTEPSPFWVDP 383 FTDDYW R+ E + G+D+GVFN++DKS++ FYQ D L +P P W P Sbjct: 410 FTDDYWERMNEDYLYGGHDMGVFNLKDKSVKHFYQLDALKIQPPPCWFLP 459