BLASTX nr result
ID: Panax21_contig00028544
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00028544 (727 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002307634.1| predicted protein [Populus trichocarpa] gi|2... 64 2e-08 ref|XP_004146987.1| PREDICTED: 2-dehydro-3-deoxygluconokinase-li... 63 7e-08 ref|XP_003536926.1| PREDICTED: fructokinase-1-like [Glycine max] 63 7e-08 ref|XP_002521000.1| ribokinase, putative [Ricinus communis] gi|2... 63 7e-08 ref|XP_003541336.1| PREDICTED: fructokinase-1-like [Glycine max] 62 9e-08 >ref|XP_002307634.1| predicted protein [Populus trichocarpa] gi|222857083|gb|EEE94630.1| predicted protein [Populus trichocarpa] Length = 394 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/40 (77%), Positives = 33/40 (82%) Frame = +2 Query: 236 VATLGNLCVDIILNVPKLTPSSPEQCKAYMDELSKSPPEK 355 VATLGNLCVDI+LNVPKL P S E AYM ELSKSPP+K Sbjct: 3 VATLGNLCVDIVLNVPKLPPRSREASFAYMQELSKSPPDK 42 >ref|XP_004146987.1| PREDICTED: 2-dehydro-3-deoxygluconokinase-like [Cucumis sativus] gi|449517273|ref|XP_004165670.1| PREDICTED: 2-dehydro-3-deoxygluconokinase-like [Cucumis sativus] Length = 480 Score = 62.8 bits (151), Expect = 7e-08 Identities = 28/45 (62%), Positives = 36/45 (80%) Frame = +2 Query: 221 TKNFYVATLGNLCVDIILNVPKLTPSSPEQCKAYMDELSKSPPEK 355 +K+ VATLGNLCVDI+LNVP L P + ++ +AYM+ LS SPPEK Sbjct: 77 SKDIDVATLGNLCVDIVLNVPSLPPENDDERRAYMERLSSSPPEK 121 >ref|XP_003536926.1| PREDICTED: fructokinase-1-like [Glycine max] Length = 467 Score = 62.8 bits (151), Expect = 7e-08 Identities = 29/46 (63%), Positives = 37/46 (80%) Frame = +2 Query: 218 LTKNFYVATLGNLCVDIILNVPKLTPSSPEQCKAYMDELSKSPPEK 355 + K+ VATL NLCVDI+LNVP+L P SP Q KA+MD L++SPP+K Sbjct: 61 VAKHVDVATLSNLCVDIVLNVPQLPPPSPLQRKAFMDRLAQSPPDK 106 >ref|XP_002521000.1| ribokinase, putative [Ricinus communis] gi|223539837|gb|EEF41417.1| ribokinase, putative [Ricinus communis] Length = 474 Score = 62.8 bits (151), Expect = 7e-08 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = +2 Query: 236 VATLGNLCVDIILNVPKLTPSSPEQCKAYMDELSKSPPEK 355 V+TLGNLCVDI+LNVPKL P SP+ +AYM++LS SPP K Sbjct: 75 VSTLGNLCVDIVLNVPKLPPRSPDARQAYMEQLSTSPPHK 114 >ref|XP_003541336.1| PREDICTED: fructokinase-1-like [Glycine max] Length = 472 Score = 62.4 bits (150), Expect = 9e-08 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = +2 Query: 224 KNFYVATLGNLCVDIILNVPKLTPSSPEQCKAYMDELSKSPPEK 355 K+ VATL NLCVDI+LNVP+L P SP Q KA+MD L++SPP+K Sbjct: 68 KHVDVATLSNLCVDIVLNVPQLPPPSPLQRKAFMDRLAQSPPDK 111