BLASTX nr result
ID: Panax21_contig00028452
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00028452 (622 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002887590.1| expressed protein [Arabidopsis lyrata subsp.... 74 2e-11 ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799... 74 2e-11 ref|NP_001117603.1| conserved peptide upstream open reading fram... 72 8e-11 ref|NP_001118342.1| uncharacterized protein [Arabidopsis thalian... 64 3e-08 ref|NP_001119115.1| uncharacerized protein [Arabidopsis thaliana... 60 3e-07 >ref|XP_002887590.1| expressed protein [Arabidopsis lyrata subsp. lyrata] gi|297333431|gb|EFH63849.1| expressed protein [Arabidopsis lyrata subsp. lyrata] Length = 53 Score = 74.3 bits (181), Expect = 2e-11 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = -2 Query: 336 FMSPVLSEILLSGYTINSSLHRRTHLVQSLSVVFLYWFYVFS 211 FMSPV+SEIL SG TI+SSL RRTHLVQS SVVFLYWFYVFS Sbjct: 12 FMSPVISEILRSGLTIDSSLRRRTHLVQSFSVVFLYWFYVFS 53 >ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799960 [Glycine max] gi|356564302|ref|XP_003550394.1| PREDICTED: uncharacterized protein LOC100799844 [Glycine max] Length = 41 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 333 MSPVLSEILLSGYTINSSLHRRTHLVQSLSVVFLYWFYVFS 211 MSPVLSEIL SG+ INSSL RRTHLVQS SVVFLYWFYVFS Sbjct: 1 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|NP_001117603.1| conserved peptide upstream open reading frame 5 [Arabidopsis thaliana] gi|332197591|gb|AEE35712.1| conserved peptide upstream open reading frame 5 [Arabidopsis thaliana] Length = 41 Score = 72.0 bits (175), Expect = 8e-11 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -2 Query: 333 MSPVLSEILLSGYTINSSLHRRTHLVQSLSVVFLYWFYVFS 211 MSPV+SEIL SG TI+SSL RRTHLVQS SVVFLYWFYVFS Sbjct: 1 MSPVISEILRSGLTIDSSLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|NP_001118342.1| uncharacterized protein [Arabidopsis thaliana] gi|330251639|gb|AEC06733.1| uncharacterized protein [Arabidopsis thaliana] Length = 41 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -2 Query: 333 MSPVLSEILLSGYTINSSLHRRTHLVQSLSVVFLYWFY 220 M+PVL EILLSG T+ S+L RRTHLVQS SVVFLYWFY Sbjct: 1 MTPVLCEILLSGLTVKSALCRRTHLVQSFSVVFLYWFY 38 >ref|NP_001119115.1| uncharacerized protein [Arabidopsis thaliana] gi|332660996|gb|AEE86396.1| uncharacerized protein [Arabidopsis thaliana] Length = 42 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/42 (69%), Positives = 34/42 (80%), Gaps = 1/42 (2%) Frame = -2 Query: 333 MSPV-LSEILLSGYTINSSLHRRTHLVQSLSVVFLYWFYVFS 211 MSP+ LSEI LSG+ +NS++ RRTHLVQS SVVFLYW Y S Sbjct: 1 MSPIILSEIFLSGFMLNSTIRRRTHLVQSFSVVFLYWLYYVS 42