BLASTX nr result
ID: Panax21_contig00028382
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00028382 (704 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271523.1| PREDICTED: homeobox-leucine zipper protein A... 56 6e-06 >ref|XP_002271523.1| PREDICTED: homeobox-leucine zipper protein ATHB-12 [Vitis vinifera] gi|302143960|emb|CBI23065.3| unnamed protein product [Vitis vinifera] Length = 225 Score = 56.2 bits (134), Expect = 6e-06 Identities = 30/66 (45%), Positives = 35/66 (53%) Frame = -1 Query: 704 DHSLIMHSDDDERGNTGYPPQYEEPELLSLCEQLDGSLTPTHEKWCNFESSGISNHSCGN 525 DH L+ SDDD+ + GY E PELL CE D SL T KW F S G + SC Sbjct: 158 DHRLVKCSDDDKSRSAGYFGHQEGPELLDKCENADISLEST-GKWFGFASGGFHDQSCTI 216 Query: 524 SNWWEF 507 S W+F Sbjct: 217 SQLWDF 222