BLASTX nr result
ID: Panax21_contig00028377
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00028377 (381 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528222.1| UDP-glucuronate 5-epimerase, putative [Ricin... 82 5e-14 ref|XP_004162690.1| PREDICTED: UDP-glucuronate 4-epimerase 1-lik... 80 2e-13 ref|XP_004144711.1| PREDICTED: UDP-glucuronate 4-epimerase 1-lik... 80 2e-13 ref|XP_003549520.1| PREDICTED: UDP-glucuronate 4-epimerase 1-lik... 79 4e-13 ref|XP_003519171.1| PREDICTED: UDP-glucuronate 4-epimerase 1-lik... 79 4e-13 >ref|XP_002528222.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis] gi|223532383|gb|EEF34179.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis] Length = 433 Score = 82.0 bits (201), Expect = 5e-14 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +3 Query: 3 RRELGYKPTTDLQTGLKKFVRWYLSYYGYNHGKAVN 110 RRELGYKPTTDLQTGLKKFVRWYLSYYGYNHGKAVN Sbjct: 398 RRELGYKPTTDLQTGLKKFVRWYLSYYGYNHGKAVN 433 >ref|XP_004162690.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Cucumis sativus] Length = 431 Score = 80.1 bits (196), Expect = 2e-13 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +3 Query: 3 RRELGYKPTTDLQTGLKKFVRWYLSYYGYNHGKAVN 110 RRELGYKPTTDLQTGLKKFVRWYLSYYGYNHGK VN Sbjct: 396 RRELGYKPTTDLQTGLKKFVRWYLSYYGYNHGKPVN 431 >ref|XP_004144711.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Cucumis sativus] Length = 431 Score = 80.1 bits (196), Expect = 2e-13 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +3 Query: 3 RRELGYKPTTDLQTGLKKFVRWYLSYYGYNHGKAVN 110 RRELGYKPTTDLQTGLKKFVRWYLSYYGYNHGK VN Sbjct: 396 RRELGYKPTTDLQTGLKKFVRWYLSYYGYNHGKPVN 431 >ref|XP_003549520.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Glycine max] Length = 431 Score = 79.0 bits (193), Expect = 4e-13 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 3 RRELGYKPTTDLQTGLKKFVRWYLSYYGYNHGKAVN 110 RRELGYKPTTDLQTGLKKFV+WYLSYYGYNHGK VN Sbjct: 396 RRELGYKPTTDLQTGLKKFVKWYLSYYGYNHGKPVN 431 >ref|XP_003519171.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Glycine max] Length = 431 Score = 79.0 bits (193), Expect = 4e-13 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 3 RRELGYKPTTDLQTGLKKFVRWYLSYYGYNHGKAVN 110 RRELGYKPTTDLQTGLKKFV+WYLSYYGYNHGK VN Sbjct: 396 RRELGYKPTTDLQTGLKKFVKWYLSYYGYNHGKPVN 431