BLASTX nr result
ID: Panax21_contig00027822
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00027822 (395 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI14900.3| unnamed protein product [Vitis vinifera] 61 1e-07 ref|XP_002278192.1| PREDICTED: BTB/POZ and TAZ domain-containing... 61 1e-07 ref|XP_002511276.1| protein binding protein, putative [Ricinus c... 57 3e-07 ref|NP_201121.1| BTB and TAZ domain protein 1 [Arabidopsis thali... 56 3e-06 >emb|CBI14900.3| unnamed protein product [Vitis vinifera] Length = 347 Score = 60.8 bits (146), Expect = 1e-07 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = -1 Query: 395 RVPLCRQYKLKAQSSEKMKEDDSRWKLLVRKVVSAKTISSLSM 267 RVPLCRQ+KLKAQ +K +D+RWKLLVRKVVSAK +SSLS+ Sbjct: 283 RVPLCRQFKLKAQQVKK--GEDARWKLLVRKVVSAKAMSSLSL 323 >ref|XP_002278192.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Vitis vinifera] Length = 351 Score = 60.8 bits (146), Expect = 1e-07 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = -1 Query: 395 RVPLCRQYKLKAQSSEKMKEDDSRWKLLVRKVVSAKTISSLSM 267 RVPLCRQ+KLKAQ +K +D+RWKLLVRKVVSAK +SSLS+ Sbjct: 287 RVPLCRQFKLKAQQVKK--GEDARWKLLVRKVVSAKAMSSLSL 327 >ref|XP_002511276.1| protein binding protein, putative [Ricinus communis] gi|223550391|gb|EEF51878.1| protein binding protein, putative [Ricinus communis] Length = 363 Score = 57.4 bits (137), Expect(2) = 3e-07 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -1 Query: 395 RVPLCRQYKLKAQSSEKMKEDDSRWKLLVRKVVSAKTISSLSM 267 RVPLCRQ+KLK Q +K DD+ WKLLVRKVVSA+ +SSLS+ Sbjct: 300 RVPLCRQFKLKMQHEKK--GDDALWKLLVRKVVSARVLSSLSL 340 Score = 21.9 bits (45), Expect(2) = 3e-07 Identities = 7/10 (70%), Positives = 10/10 (100%) Frame = -3 Query: 213 HNHGIRSFKL 184 H+HGIR+F+L Sbjct: 354 HDHGIRTFRL 363 >ref|NP_201121.1| BTB and TAZ domain protein 1 [Arabidopsis thaliana] gi|75309213|sp|Q9FMK7.1|BT1_ARATH RecName: Full=BTB/POZ and TAZ domain-containing protein 1; AltName: Full=BTB and TAZ domain protein 1 gi|10177297|dbj|BAB10558.1| unnamed protein product [Arabidopsis thaliana] gi|36955895|gb|AAQ87004.1| BTB and TAZ domain protein 1 [Arabidopsis thaliana] gi|38603810|gb|AAR24650.1| At5g63160 [Arabidopsis thaliana] gi|110742799|dbj|BAE99302.1| hypothetical protein [Arabidopsis thaliana] gi|332010329|gb|AED97712.1| BTB and TAZ domain protein 1 [Arabidopsis thaliana] Length = 365 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/44 (61%), Positives = 35/44 (79%) Frame = -1 Query: 395 RVPLCRQYKLKAQSSEKMKEDDSRWKLLVRKVVSAKTISSLSMS 264 RVPLCRQYK + + +KM ED ++WK+LVR+V SAK +SSLS S Sbjct: 299 RVPLCRQYKNRGEKDKKMVED-TKWKVLVRRVASAKAMSSLSQS 341