BLASTX nr result
ID: Panax21_contig00027756
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00027756 (466 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_001109553.1| hypothetical protein Poptr_cp075 [Populus tr... 178 5e-43 ref|XP_003638717.1| Cell wall-associated hydrolase [Medicago tru... 78 6e-13 ref|XP_003611001.1| hypothetical protein MTR_5g009380 [Medicago ... 55 3e-06 emb|CAN83161.1| hypothetical protein VITISV_022556 [Vitis vinifera] 55 6e-06 >ref|YP_001109553.1| hypothetical protein Poptr_cp075 [Populus trichocarpa] gi|134093265|ref|YP_001109566.1| hypothetical protein Poptr_cp088 [Populus trichocarpa] gi|133712114|gb|ABO36757.1| hypothetical protein Poptr_cp075 [Populus trichocarpa] gi|133712127|gb|ABO36770.1| hypothetical protein Poptr_cp088 [Populus trichocarpa] Length = 86 Score = 178 bits (451), Expect = 5e-43 Identities = 82/91 (90%), Positives = 84/91 (92%) Frame = -3 Query: 275 MDWCGSSTPRTPEYRTMNEERHERKAYWLVIVRPQFLTGGDTKGLCPSIPWIDREGGQSF 96 MDWCGSSTPRTPEYRTMNEERHERKAYWLVIVRPQFLTGGDTKGLCPSI WIDREGG+SF Sbjct: 1 MDWCGSSTPRTPEYRTMNEERHERKAYWLVIVRPQFLTGGDTKGLCPSITWIDREGGRSF 60 Query: 95 WFFVEQGFFRVVKELNNENRWRVPDRIDRVM 3 WF FF VVKELNN+NRWRVPDRIDRVM Sbjct: 61 WF-----FFHVVKELNNKNRWRVPDRIDRVM 86 >ref|XP_003638717.1| Cell wall-associated hydrolase [Medicago truncatula] gi|355504652|gb|AES85855.1| Cell wall-associated hydrolase [Medicago truncatula] Length = 385 Score = 78.2 bits (191), Expect = 6e-13 Identities = 41/83 (49%), Positives = 47/83 (56%) Frame = -3 Query: 275 MDWCGSSTPRTPEYRTMNEERHERKAYWLVIVRPQFLTGGDTKGLCPSIPWIDREGGQSF 96 MDWCGSSTPRTPEYRTMNE + KA ++P R+GGQ F Sbjct: 1 MDWCGSSTPRTPEYRTMNEVKRTPKA--------------------SALPSYSRDGGQRF 40 Query: 95 WFFVEQGFFRVVKELNNENRWRV 27 W FF VVKELNN+NRWR+ Sbjct: 41 W------FFHVVKELNNQNRWRL 57 >ref|XP_003611001.1| hypothetical protein MTR_5g009380 [Medicago truncatula] gi|355512336|gb|AES93959.1| hypothetical protein MTR_5g009380 [Medicago truncatula] Length = 54 Score = 54.7 bits (130), Expect(2) = 3e-06 Identities = 25/43 (58%), Positives = 31/43 (72%) Frame = -3 Query: 134 SIPWIDREGGQSFWFFVEQGFFRVVKELNNENRWRVPDRIDRV 6 ++P R+GGQ FWFF VVKELNN+NRWR+ DRID+V Sbjct: 12 ALPSYSRDGGQRFWFF------HVVKELNNQNRWRLSDRIDQV 48 Score = 21.6 bits (44), Expect(2) = 3e-06 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -1 Query: 154 TPKASALPS 128 TPKASALPS Sbjct: 7 TPKASALPS 15 >emb|CAN83161.1| hypothetical protein VITISV_022556 [Vitis vinifera] Length = 486 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +2 Query: 164 SRIGASQSLANMLFSHAFLRSWFDIL 241 SRIGASQSLANMLFSHAFLRSWFDIL Sbjct: 304 SRIGASQSLANMLFSHAFLRSWFDIL 329