BLASTX nr result
ID: Panax21_contig00027702
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00027702 (395 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEX93709.1| ATP synthase CF0 subunit IV (chloroplast) [Allium... 54 1e-05 >gb|AEX93709.1| ATP synthase CF0 subunit IV (chloroplast) [Allium fistulosum] Length = 247 Score = 54.3 bits (129), Expect = 1e-05 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 179 EVGQHVGWKIGGL*VHNQVLITSCVVIAILLGS 81 EVGQH+ WKIGGL +H QVLITS VVIAILLGS Sbjct: 21 EVGQHLYWKIGGLQIHAQVLITSWVVIAILLGS 53