BLASTX nr result
ID: Panax21_contig00027241
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00027241 (521 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBL52074.1| hypothetical protein (mitochondrion) [Beta vulga... 60 1e-07 dbj|BAG48198.1| hypothetical protein [Beta vulgaris] 60 1e-07 >emb|CBL52074.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 132 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +1 Query: 406 MNPNILEFLSDMAKEILTIAGVAYIPLVVLLVFRAGRL 519 MNP IL+FL+DMA ILTIAGVAY+PL+VL+VFRAG L Sbjct: 4 MNPYILQFLADMATAILTIAGVAYLPLIVLIVFRAGGL 41 >dbj|BAG48198.1| hypothetical protein [Beta vulgaris] Length = 129 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +1 Query: 406 MNPNILEFLSDMAKEILTIAGVAYIPLVVLLVFRAGRL 519 MNP IL+FL+DMA ILTIAGVAY+PL+VL+VFRAG L Sbjct: 1 MNPYILQFLADMATAILTIAGVAYLPLIVLIVFRAGGL 38