BLASTX nr result
ID: Panax21_contig00026876
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00026876 (684 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002447342.1| hypothetical protein SORBIDRAFT_06g033280 [S... 64 1e-15 ref|NP_001140792.1| uncharacterized protein LOC100272867 [Zea ma... 64 1e-15 ref|NP_001239937.1| uncharacterized protein LOC100819768 [Glycin... 64 1e-15 ref|XP_003623886.1| Phosphomannomutase D1 [Medicago truncatula] ... 64 2e-15 gb|EEC78272.1| hypothetical protein OsI_17966 [Oryza sativa Indi... 64 2e-15 >ref|XP_002447342.1| hypothetical protein SORBIDRAFT_06g033280 [Sorghum bicolor] gi|241938525|gb|EES11670.1| hypothetical protein SORBIDRAFT_06g033280 [Sorghum bicolor] Length = 249 Score = 64.3 bits (155), Expect(2) = 1e-15 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +1 Query: 583 KGTFKLFRSGMINVSPIGQNCSQEERDEFKKYDK 684 +GTF FRSGMINVSPIG+NCSQEERDEF+KYDK Sbjct: 119 RGTFIEFRSGMINVSPIGRNCSQEERDEFEKYDK 152 Score = 44.3 bits (103), Expect(2) = 1e-15 Identities = 19/21 (90%), Positives = 21/21 (100%) Frame = +3 Query: 417 MQEFINFTLHYIADLDIPIKR 479 ++EFINFTLHYIADLDIPIKR Sbjct: 99 LKEFINFTLHYIADLDIPIKR 119 >ref|NP_001140792.1| uncharacterized protein LOC100272867 [Zea mays] gi|194701096|gb|ACF84632.1| unknown [Zea mays] gi|194701110|gb|ACF84639.1| unknown [Zea mays] gi|223947667|gb|ACN27917.1| unknown [Zea mays] gi|238009672|gb|ACR35871.1| unknown [Zea mays] gi|414584724|tpg|DAA35295.1| TPA: hypothetical protein ZEAMMB73_474117 [Zea mays] gi|414584725|tpg|DAA35296.1| TPA: hypothetical protein ZEAMMB73_474117 [Zea mays] gi|414584726|tpg|DAA35297.1| TPA: hypothetical protein ZEAMMB73_474117 [Zea mays] gi|414584727|tpg|DAA35298.1| TPA: hypothetical protein ZEAMMB73_474117 [Zea mays] gi|414584728|tpg|DAA35299.1| TPA: hypothetical protein ZEAMMB73_474117 [Zea mays] Length = 249 Score = 64.3 bits (155), Expect(2) = 1e-15 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +1 Query: 583 KGTFKLFRSGMINVSPIGQNCSQEERDEFKKYDK 684 +GTF FRSGMINVSPIG+NCSQEERDEF+KYDK Sbjct: 119 RGTFIEFRSGMINVSPIGRNCSQEERDEFEKYDK 152 Score = 44.3 bits (103), Expect(2) = 1e-15 Identities = 19/21 (90%), Positives = 21/21 (100%) Frame = +3 Query: 417 MQEFINFTLHYIADLDIPIKR 479 ++EFINFTLHYIADLDIPIKR Sbjct: 99 LKEFINFTLHYIADLDIPIKR 119 >ref|NP_001239937.1| uncharacterized protein LOC100819768 [Glycine max] gi|255635447|gb|ACU18076.1| unknown [Glycine max] Length = 247 Score = 64.3 bits (155), Expect(2) = 1e-15 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +1 Query: 583 KGTFKLFRSGMINVSPIGQNCSQEERDEFKKYDK 684 +GTF FRSGM+NVSPIG+NCSQEERDEF+KYDK Sbjct: 117 RGTFMEFRSGMLNVSPIGRNCSQEERDEFEKYDK 150 Score = 44.3 bits (103), Expect(2) = 1e-15 Identities = 19/21 (90%), Positives = 21/21 (100%) Frame = +3 Query: 417 MQEFINFTLHYIADLDIPIKR 479 ++EFINFTLHYIADLDIPIKR Sbjct: 97 LKEFINFTLHYIADLDIPIKR 117 >ref|XP_003623886.1| Phosphomannomutase D1 [Medicago truncatula] gi|355498901|gb|AES80104.1| Phosphomannomutase D1 [Medicago truncatula] Length = 288 Score = 63.5 bits (153), Expect(2) = 2e-15 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +1 Query: 583 KGTFKLFRSGMINVSPIGQNCSQEERDEFKKYDK 684 +GTF FRSGM+NVSPIG+NCSQEERDEF+KYDK Sbjct: 117 RGTFIEFRSGMLNVSPIGRNCSQEERDEFEKYDK 150 Score = 44.3 bits (103), Expect(2) = 2e-15 Identities = 19/21 (90%), Positives = 21/21 (100%) Frame = +3 Query: 417 MQEFINFTLHYIADLDIPIKR 479 ++EFINFTLHYIADLDIPIKR Sbjct: 97 LKEFINFTLHYIADLDIPIKR 117 >gb|EEC78272.1| hypothetical protein OsI_17966 [Oryza sativa Indica Group] Length = 256 Score = 63.5 bits (153), Expect(2) = 2e-15 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +1 Query: 583 KGTFKLFRSGMINVSPIGQNCSQEERDEFKKYDK 684 +GTF FRSGM+NVSPIG+NCSQEERDEF+KYDK Sbjct: 126 RGTFIEFRSGMLNVSPIGRNCSQEERDEFEKYDK 159 Score = 44.3 bits (103), Expect(2) = 2e-15 Identities = 19/21 (90%), Positives = 21/21 (100%) Frame = +3 Query: 417 MQEFINFTLHYIADLDIPIKR 479 ++EFINFTLHYIADLDIPIKR Sbjct: 106 LKEFINFTLHYIADLDIPIKR 126