BLASTX nr result
ID: Panax21_contig00026727
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00026727 (860 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003555908.1| PREDICTED: nuclease S1-like [Glycine max] 51 1e-08 ref|XP_002315936.1| predicted protein [Populus trichocarpa] gi|2... 49 1e-08 ref|XP_002282829.1| PREDICTED: nuclease S1 isoform 1 [Vitis vini... 50 3e-08 gb|AAD00694.1| bifunctional nuclease [Zinnia violacea] 51 5e-08 ref|NP_176996.1| endonuclease 2 [Arabidopsis thaliana] gi|751697... 48 7e-08 >ref|XP_003555908.1| PREDICTED: nuclease S1-like [Glycine max] Length = 284 Score = 51.2 bits (121), Expect(2) = 1e-08 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +2 Query: 155 DDYFLTHLTIVNRRLAQGGVRLAATLNHIFG 247 DDYFL+ L +V+ RLAQGGVRLAATLN IFG Sbjct: 254 DDYFLSRLPVVSLRLAQGGVRLAATLNRIFG 284 Score = 34.7 bits (78), Expect(2) = 1e-08 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +1 Query: 25 AACDWSYKGASEGSVLE 75 AAC W+YKGA EGSVLE Sbjct: 237 AACQWAYKGAPEGSVLE 253 >ref|XP_002315936.1| predicted protein [Populus trichocarpa] gi|222864976|gb|EEF02107.1| predicted protein [Populus trichocarpa] Length = 290 Score = 48.9 bits (115), Expect(2) = 1e-08 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = +2 Query: 155 DDYFLTHLTIVNRRLAQGGVRLAATLNHIF 244 DDYFL+ L IV RLAQGGVRLAATLN IF Sbjct: 260 DDYFLSRLPIVKLRLAQGGVRLAATLNRIF 289 Score = 36.6 bits (83), Expect(2) = 1e-08 Identities = 14/17 (82%), Positives = 17/17 (100%) Frame = +1 Query: 25 AACDWSYKGASEGSVLE 75 AACDW+YKGA+EG+VLE Sbjct: 243 AACDWAYKGAAEGTVLE 259 >ref|XP_002282829.1| PREDICTED: nuclease S1 isoform 1 [Vitis vinifera] gi|297737807|emb|CBI27008.3| unnamed protein product [Vitis vinifera] Length = 285 Score = 50.4 bits (119), Expect(2) = 3e-08 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = +2 Query: 155 DDYFLTHLTIVNRRLAQGGVRLAATLNHIFG 247 DDYFL+ L I+ RLAQGGVRLAATLN IFG Sbjct: 255 DDYFLSRLPIITFRLAQGGVRLAATLNRIFG 285 Score = 33.9 bits (76), Expect(2) = 3e-08 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = +1 Query: 25 AACDWSYKGASEGSVLE 75 AACDWSYKG E SVLE Sbjct: 238 AACDWSYKGVREDSVLE 254 >gb|AAD00694.1| bifunctional nuclease [Zinnia violacea] Length = 280 Score = 51.2 bits (121), Expect(2) = 5e-08 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +2 Query: 155 DDYFLTHLTIVNRRLAQGGVRLAATLNHIFG 247 DDYFL+ L IVN RLAQGGVRLAA LN IFG Sbjct: 250 DDYFLSRLPIVNWRLAQGGVRLAANLNRIFG 280 Score = 32.3 bits (72), Expect(2) = 5e-08 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = +1 Query: 25 AACDWSYKGASEGSVLE 75 AAC+W+YKG + GSVLE Sbjct: 233 AACNWAYKGVTNGSVLE 249 >ref|NP_176996.1| endonuclease 2 [Arabidopsis thaliana] gi|75169708|sp|Q9C9G4.1|ENDO2_ARATH RecName: Full=Endonuclease 2; Short=AtENDO2; AltName: Full=Deoxyribonuclease ENDO2; AltName: Full=Single-stranded-nucleate endonuclease ENDO2; Flags: Precursor gi|12325316|gb|AAG52597.1|AC016447_6 putative bifunctional nuclease; 47147-45601 [Arabidopsis thaliana] gi|332196656|gb|AEE34777.1| endonuclease 2 [Arabidopsis thaliana] Length = 290 Score = 48.1 bits (113), Expect(2) = 7e-08 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = +2 Query: 155 DDYFLTHLTIVNRRLAQGGVRLAATLNHIFG 247 D+YF + L IV +RLAQGGVRLAATLN IFG Sbjct: 260 DEYFYSRLPIVYQRLAQGGVRLAATLNRIFG 290 Score = 35.0 bits (79), Expect(2) = 7e-08 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = +1 Query: 25 AACDWSYKGASEGSVLEGK*FF 90 AACDW+YKG +EG LE + F+ Sbjct: 243 AACDWAYKGVTEGDTLEDEYFY 264