BLASTX nr result
ID: Panax21_contig00026584
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00026584 (362 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272634.2| PREDICTED: uncharacterized amino acid permea... 59 5e-07 emb|CBI16645.3| unnamed protein product [Vitis vinifera] 59 5e-07 emb|CAN66397.1| hypothetical protein VITISV_020825 [Vitis vinifera] 59 5e-07 ref|XP_002511602.1| cationic amino acid transporter, putative [R... 58 9e-07 ref|XP_002302490.1| cationic amino acid transporter [Populus tri... 56 3e-06 >ref|XP_002272634.2| PREDICTED: uncharacterized amino acid permease YhdG-like [Vitis vinifera] Length = 574 Score = 58.5 bits (140), Expect = 5e-07 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = -3 Query: 123 GSEEMFWALSFNILAPILLVLLTVILCRGVGESSILNSLMT 1 G E + ALS NILAPILLVLLT+ILCRGVGESS +N MT Sbjct: 181 GEEFLGGALSINILAPILLVLLTIILCRGVGESSAVNCFMT 221 >emb|CBI16645.3| unnamed protein product [Vitis vinifera] Length = 600 Score = 58.5 bits (140), Expect = 5e-07 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = -3 Query: 123 GSEEMFWALSFNILAPILLVLLTVILCRGVGESSILNSLMT 1 G E + ALS NILAPILLVLLT+ILCRGVGESS +N MT Sbjct: 207 GEEFLGGALSINILAPILLVLLTIILCRGVGESSAVNCFMT 247 >emb|CAN66397.1| hypothetical protein VITISV_020825 [Vitis vinifera] Length = 623 Score = 58.5 bits (140), Expect = 5e-07 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = -3 Query: 123 GSEEMFWALSFNILAPILLVLLTVILCRGVGESSILNSLMT 1 G E + ALS NILAPILLVLLT+ILCRGVGESS +N MT Sbjct: 207 GEEFLGGALSINILAPILLVLLTIILCRGVGESSAVNCFMT 247 >ref|XP_002511602.1| cationic amino acid transporter, putative [Ricinus communis] gi|223548782|gb|EEF50271.1| cationic amino acid transporter, putative [Ricinus communis] Length = 568 Score = 57.8 bits (138), Expect = 9e-07 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = -3 Query: 126 NGSEEMFWA-LSFNILAPILLVLLTVILCRGVGESSILNSLMT 1 +G +E F LS NILAPILL LLTV+LC GVGESSILNS MT Sbjct: 174 HGGQEFFGGTLSINILAPILLALLTVVLCWGVGESSILNSFMT 216 >ref|XP_002302490.1| cationic amino acid transporter [Populus trichocarpa] gi|222844216|gb|EEE81763.1| cationic amino acid transporter [Populus trichocarpa] Length = 577 Score = 56.2 bits (134), Expect = 3e-06 Identities = 30/43 (69%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = -3 Query: 126 NGSEEMFWA-LSFNILAPILLVLLTVILCRGVGESSILNSLMT 1 +G EE F LS N+LAP LL LLTVILC GVGESSI+NS MT Sbjct: 177 HGGEEFFGGTLSINLLAPFLLALLTVILCLGVGESSIVNSFMT 219