BLASTX nr result
ID: Panax21_contig00025488
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00025488 (632 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI29716.3| unnamed protein product [Vitis vinifera] 72 1e-10 ref|XP_002263729.1| PREDICTED: uncharacterized protein LOC100268... 72 1e-10 emb|CAN72133.1| hypothetical protein VITISV_042261 [Vitis vinifera] 69 9e-10 ref|XP_002533882.1| conserved hypothetical protein [Ricinus comm... 67 3e-09 ref|XP_002265212.2| PREDICTED: uncharacterized protein LOC100257... 65 1e-08 >emb|CBI29716.3| unnamed protein product [Vitis vinifera] Length = 258 Score = 71.6 bits (174), Expect = 1e-10 Identities = 38/59 (64%), Positives = 45/59 (76%) Frame = +1 Query: 13 FYMSNKIRTQTVVLREAYKKDALVEMPPLMDMRYRYIYLMNRAVKCRKPIKVRADVRNK 189 FY+SNKIRTQTVVLREAY+KD L+E PLM MR+RYI+LMN++ K R AD NK Sbjct: 176 FYVSNKIRTQTVVLREAYRKDFLLENHPLMGMRHRYIHLMNKSEKTRYQ---NADFLNK 231 >ref|XP_002263729.1| PREDICTED: uncharacterized protein LOC100268137 [Vitis vinifera] Length = 396 Score = 71.6 bits (174), Expect = 1e-10 Identities = 38/59 (64%), Positives = 45/59 (76%) Frame = +1 Query: 13 FYMSNKIRTQTVVLREAYKKDALVEMPPLMDMRYRYIYLMNRAVKCRKPIKVRADVRNK 189 FY+SNKIRTQTVVLREAY+KD L+E PLM MR+RYI+LMN++ K R AD NK Sbjct: 314 FYVSNKIRTQTVVLREAYRKDFLLENHPLMGMRHRYIHLMNKSEKTRYQ---NADFLNK 369 >emb|CAN72133.1| hypothetical protein VITISV_042261 [Vitis vinifera] Length = 396 Score = 68.6 bits (166), Expect = 9e-10 Identities = 36/59 (61%), Positives = 44/59 (74%) Frame = +1 Query: 13 FYMSNKIRTQTVVLREAYKKDALVEMPPLMDMRYRYIYLMNRAVKCRKPIKVRADVRNK 189 FY+SNKI+T TVVLREAY+KD L+E PLM MR+RYI+LMN++ K R AD NK Sbjct: 314 FYVSNKIKTHTVVLREAYRKDFLLENHPLMGMRHRYIHLMNKSEKMRYQ---NADFLNK 369 >ref|XP_002533882.1| conserved hypothetical protein [Ricinus communis] gi|223526167|gb|EEF28500.1| conserved hypothetical protein [Ricinus communis] Length = 440 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/45 (66%), Positives = 40/45 (88%) Frame = +1 Query: 13 FYMSNKIRTQTVVLREAYKKDALVEMPPLMDMRYRYIYLMNRAVK 147 FY+SNKIRTQTVVLREAY+KD +V PLM +R+RYI+LMN++++ Sbjct: 321 FYVSNKIRTQTVVLREAYRKDFMVVKHPLMGIRFRYIHLMNKSIE 365 >ref|XP_002265212.2| PREDICTED: uncharacterized protein LOC100257588 [Vitis vinifera] Length = 660 Score = 64.7 bits (156), Expect = 1e-08 Identities = 33/75 (44%), Positives = 48/75 (64%), Gaps = 1/75 (1%) Frame = +1 Query: 13 FYMSNKIRTQTVVLREAYKKDALVEMPPLMDMRYRYIYLMNRAVKCRKPIKV-RADVRNK 189 FY+S K TV+L+EAYK+D L+E PLM+MRY+YI+LMN A + KPI + + Sbjct: 321 FYLSTKTGMHTVLLKEAYKRDLLIEKHPLMEMRYQYIHLMNTAKEDNKPINAPGTSPKKE 380 Query: 190 QFTSSAREGVRKERL 234 Q +S G + E++ Sbjct: 381 QKNASDASGEKSEQV 395