BLASTX nr result
ID: Panax21_contig00025222
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00025222 (352 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001926395.3| PREDICTED: cellular nucleic acid-binding pro... 57 1e-06 ref|XP_002187556.2| PREDICTED: cellular nucleic acid-binding pro... 57 2e-06 gb|EMC77386.1| Cellular nucleic acid-binding protein [Columba li... 57 2e-06 gb|ELK23671.1| Cellular nucleic acid-binding protein [Myotis dav... 57 2e-06 gb|ELK15208.1| Cellular nucleic acid-binding protein [Pteropus a... 57 2e-06 >ref|XP_001926395.3| PREDICTED: cellular nucleic acid-binding protein-like [Sus scrofa] Length = 171 Score = 57.4 bits (137), Expect = 1e-06 Identities = 20/41 (48%), Positives = 28/41 (68%) Frame = -2 Query: 138 PVVCYKCGGEGHISPNCTM*SKACYNCGKEGYLARFCRVPK 16 P++CY+CG GH + NC + CYNCGK G++A+ C PK Sbjct: 45 PIICYRCGEPGHHAKNCDLQEDICYNCGKSGHIAKDCMEPK 85 >ref|XP_002187556.2| PREDICTED: cellular nucleic acid-binding protein isoform 1 [Taeniopygia guttata] Length = 170 Score = 56.6 bits (135), Expect = 2e-06 Identities = 19/41 (46%), Positives = 30/41 (73%) Frame = -2 Query: 138 PVVCYKCGGEGHISPNCTM*SKACYNCGKEGYLARFCRVPK 16 P +CY+CG GH++ +C + ACYNCG+ G++A+ C+ PK Sbjct: 44 PDICYRCGESGHLAKDCDLQEDACYNCGRGGHIAKDCKEPK 84 >gb|EMC77386.1| Cellular nucleic acid-binding protein [Columba livia] Length = 181 Score = 56.6 bits (135), Expect = 2e-06 Identities = 19/41 (46%), Positives = 30/41 (73%) Frame = -2 Query: 138 PVVCYKCGGEGHISPNCTM*SKACYNCGKEGYLARFCRVPK 16 P +CY+CG GH++ +C + ACYNCG+ G++A+ C+ PK Sbjct: 55 PDICYRCGESGHLAKDCDLQEDACYNCGRGGHIAKDCKEPK 95 >gb|ELK23671.1| Cellular nucleic acid-binding protein [Myotis davidii] Length = 142 Score = 56.6 bits (135), Expect = 2e-06 Identities = 19/41 (46%), Positives = 30/41 (73%) Frame = -2 Query: 138 PVVCYKCGGEGHISPNCTM*SKACYNCGKEGYLARFCRVPK 16 P +CY+CG GH++ +C + ACYNCG+ G++A+ C+ PK Sbjct: 16 PDICYRCGESGHLAKDCDLQEDACYNCGRGGHIAKDCKEPK 56 >gb|ELK15208.1| Cellular nucleic acid-binding protein [Pteropus alecto] Length = 189 Score = 56.6 bits (135), Expect = 2e-06 Identities = 19/41 (46%), Positives = 30/41 (73%) Frame = -2 Query: 138 PVVCYKCGGEGHISPNCTM*SKACYNCGKEGYLARFCRVPK 16 P +CY+CG GH++ +C + ACYNCG+ G++A+ C+ PK Sbjct: 63 PDICYRCGESGHLAKDCDLQEDACYNCGRGGHIAKDCKEPK 103