BLASTX nr result
ID: Panax21_contig00025027
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00025027 (453 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI35134.3| unnamed protein product [Vitis vinifera] 96 2e-18 ref|XP_002272168.1| PREDICTED: golgin candidate 6-like [Vitis vi... 96 2e-18 emb|CAN68851.1| hypothetical protein VITISV_003069 [Vitis vinifera] 96 2e-18 ref|XP_002521485.1| vesicle docking protein P115, putative [Rici... 93 2e-17 ref|XP_002298552.1| predicted protein [Populus trichocarpa] gi|2... 93 3e-17 >emb|CBI35134.3| unnamed protein product [Vitis vinifera] Length = 906 Score = 96.3 bits (238), Expect = 2e-18 Identities = 47/54 (87%), Positives = 53/54 (98%) Frame = -2 Query: 452 PIPDVESIKAEAREESQKESEAELNDLLVCLGQEQSKVEKLSARLLELGEDVEQ 291 P PD+++IKAEAREE+QKESEAELNDLLVCLGQEQSKVEKLSARLLELGEDV++ Sbjct: 833 PSPDIDAIKAEAREEAQKESEAELNDLLVCLGQEQSKVEKLSARLLELGEDVDK 886 >ref|XP_002272168.1| PREDICTED: golgin candidate 6-like [Vitis vinifera] Length = 915 Score = 96.3 bits (238), Expect = 2e-18 Identities = 47/54 (87%), Positives = 53/54 (98%) Frame = -2 Query: 452 PIPDVESIKAEAREESQKESEAELNDLLVCLGQEQSKVEKLSARLLELGEDVEQ 291 P PD+++IKAEAREE+QKESEAELNDLLVCLGQEQSKVEKLSARLLELGEDV++ Sbjct: 842 PSPDIDAIKAEAREEAQKESEAELNDLLVCLGQEQSKVEKLSARLLELGEDVDK 895 >emb|CAN68851.1| hypothetical protein VITISV_003069 [Vitis vinifera] Length = 131 Score = 96.3 bits (238), Expect = 2e-18 Identities = 47/54 (87%), Positives = 53/54 (98%) Frame = -2 Query: 452 PIPDVESIKAEAREESQKESEAELNDLLVCLGQEQSKVEKLSARLLELGEDVEQ 291 P PD+++IKAEAREE+QKESEAELNDLLVCLGQEQSKVEKLSARLLELGEDV++ Sbjct: 58 PSPDIDAIKAEAREEAQKESEAELNDLLVCLGQEQSKVEKLSARLLELGEDVDK 111 >ref|XP_002521485.1| vesicle docking protein P115, putative [Ricinus communis] gi|223539384|gb|EEF40975.1| vesicle docking protein P115, putative [Ricinus communis] Length = 911 Score = 93.2 bits (230), Expect = 2e-17 Identities = 44/52 (84%), Positives = 52/52 (100%) Frame = -2 Query: 449 IPDVESIKAEAREESQKESEAELNDLLVCLGQEQSKVEKLSARLLELGEDVE 294 +PD++++KAEAREE+QKESEAELNDLLVCLGQEQSKVEKLSA+LLELGEDV+ Sbjct: 837 VPDIKAVKAEAREEAQKESEAELNDLLVCLGQEQSKVEKLSAKLLELGEDVD 888 >ref|XP_002298552.1| predicted protein [Populus trichocarpa] gi|222845810|gb|EEE83357.1| predicted protein [Populus trichocarpa] Length = 915 Score = 92.8 bits (229), Expect = 3e-17 Identities = 45/52 (86%), Positives = 52/52 (100%) Frame = -2 Query: 446 PDVESIKAEAREESQKESEAELNDLLVCLGQEQSKVEKLSARLLELGEDVEQ 291 PDVE+I+AEAREE+QKESEAELNDLLVCLGQEQS+VEKLSARL+ELGEDV++ Sbjct: 844 PDVEAIRAEAREEAQKESEAELNDLLVCLGQEQSRVEKLSARLMELGEDVDK 895