BLASTX nr result
ID: Panax21_contig00023556
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00023556 (357 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004174042.1| PREDICTED: probable ion channel CASTOR-like,... 68 9e-10 ref|XP_004135518.1| PREDICTED: ion channel CASTOR-like [Cucumis ... 68 9e-10 ref|XP_002330696.1| predicted protein [Populus trichocarpa] gi|2... 67 1e-09 gb|ADC36212.1| CASTOR [Medicago truncatula] 67 2e-09 ref|XP_003554802.1| PREDICTED: ion channel CASTOR [Glycine max] 66 3e-09 >ref|XP_004174042.1| PREDICTED: probable ion channel CASTOR-like, partial [Cucumis sativus] Length = 132 Score = 67.8 bits (164), Expect = 9e-10 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 356 VWRGNLPKDLIVAKSAERILFCGWRRDMEDMVMVI 252 VWRG+LPKD IV KSAERIL CGWRRDMEDM+MV+ Sbjct: 4 VWRGSLPKDFIVPKSAERILLCGWRRDMEDMIMVL 38 >ref|XP_004135518.1| PREDICTED: ion channel CASTOR-like [Cucumis sativus] Length = 882 Score = 67.8 bits (164), Expect = 9e-10 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 356 VWRGNLPKDLIVAKSAERILFCGWRRDMEDMVMVI 252 VWRG+LPKD IV KSAERIL CGWRRDMEDM+MV+ Sbjct: 594 VWRGSLPKDFIVPKSAERILLCGWRRDMEDMIMVL 628 >ref|XP_002330696.1| predicted protein [Populus trichocarpa] gi|222872300|gb|EEF09431.1| predicted protein [Populus trichocarpa] Length = 884 Score = 67.4 bits (163), Expect = 1e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 356 VWRGNLPKDLIVAKSAERILFCGWRRDMEDMVMVI 252 VWRG+LPKD IV K AERILFCGWRRDMEDM+MV+ Sbjct: 597 VWRGSLPKDSIVPKPAERILFCGWRRDMEDMIMVL 631 >gb|ADC36212.1| CASTOR [Medicago truncatula] Length = 824 Score = 66.6 bits (161), Expect = 2e-09 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -2 Query: 356 VWRGNLPKDLIVAKSAERILFCGWRRDMEDMVMVI 252 VWRG+LPKD + +SAERILFCGWRRDMEDM+MV+ Sbjct: 536 VWRGSLPKDFVFPRSAERILFCGWRRDMEDMIMVL 570 >ref|XP_003554802.1| PREDICTED: ion channel CASTOR [Glycine max] Length = 846 Score = 66.2 bits (160), Expect = 3e-09 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -2 Query: 356 VWRGNLPKDLIVAKSAERILFCGWRRDMEDMVMVILQGIYYAS 228 VWRG+LPKD + KS ERILFCGWRRDMEDM+MV+ + + S Sbjct: 558 VWRGSLPKDFVYPKSPERILFCGWRRDMEDMIMVLDASLAHGS 600