BLASTX nr result
ID: Panax21_contig00023296
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00023296 (693 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274395.1| PREDICTED: uncharacterized protein LOC100248... 62 7e-11 ref|XP_002309041.1| predicted protein [Populus trichocarpa] gi|2... 50 1e-09 ref|XP_003554330.1| PREDICTED: uncharacterized protein LOC100783... 51 3e-08 emb|CAH59737.1| hypothetical protein [Plantago major] 62 1e-07 ref|XP_002531334.1| conserved hypothetical protein [Ricinus comm... 49 6e-07 >ref|XP_002274395.1| PREDICTED: uncharacterized protein LOC100248230 isoform 3 [Vitis vinifera] gi|225439745|ref|XP_002274341.1| PREDICTED: uncharacterized protein LOC100248230 isoform 1 [Vitis vinifera] gi|147801762|emb|CAN77855.1| hypothetical protein VITISV_037693 [Vitis vinifera] gi|297741478|emb|CBI32610.3| unnamed protein product [Vitis vinifera] Length = 293 Score = 62.0 bits (149), Expect(2) = 7e-11 Identities = 35/67 (52%), Positives = 43/67 (64%), Gaps = 1/67 (1%) Frame = +2 Query: 317 ALLAQSGYAKNESPKHS-PMTWPSDKKLVSAFKGSREKEGLLETKVCVTWAPDVYDPPPT 493 A L ++ K+ SP S + P+ KLVSA KGSR+KEG+ K+ VTWAPDVYDPPPT Sbjct: 128 ATLQENYSLKSLSPDISRTASLPTPLKLVSAMKGSRDKEGIPLKKLNVTWAPDVYDPPPT 187 Query: 494 SDDHLER 514 H R Sbjct: 188 IVSHTVR 194 Score = 30.8 bits (68), Expect(2) = 7e-11 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +3 Query: 510 KDKKQVQKYGGSSNKCFKTLEDNEKLVGS 596 KDKKQ++K GS ++ F++ E +KL+ S Sbjct: 224 KDKKQLRKIVGSGDRGFRSFEVRDKLIAS 252 >ref|XP_002309041.1| predicted protein [Populus trichocarpa] gi|222855017|gb|EEE92564.1| predicted protein [Populus trichocarpa] Length = 229 Score = 50.4 bits (119), Expect(2) = 1e-09 Identities = 25/50 (50%), Positives = 31/50 (62%) Frame = +2 Query: 356 PKHSPMTWPSDKKLVSAFKGSREKEGLLETKVCVTWAPDVYDPPPTSDDH 505 P+ P + +VSA KGSREK+G K+ V+WAPDVYDP P S H Sbjct: 85 PEEFPHLNSTRLPIVSAMKGSREKQGGSPRKLTVSWAPDVYDPIPNSLSH 134 Score = 38.1 bits (87), Expect(2) = 1e-09 Identities = 19/33 (57%), Positives = 24/33 (72%), Gaps = 3/33 (9%) Frame = +3 Query: 510 KDKKQVQKYGGSSNKCFKTL---EDNEKLVGSP 599 KDKKQ +K GG S+KC+KT+ ED + VGSP Sbjct: 174 KDKKQFRKSGGRSDKCYKTMDAPEDTDFGVGSP 206 >ref|XP_003554330.1| PREDICTED: uncharacterized protein LOC100783136 [Glycine max] Length = 254 Score = 51.2 bits (121), Expect(2) = 3e-08 Identities = 25/51 (49%), Positives = 30/51 (58%) Frame = +2 Query: 380 PSDKKLVSAFKGSREKEGLLETKVCVTWAPDVYDPPPTSDDHLERQEASSE 532 P+ KL+SA KGSREK G + K+ V WA DVYDP PT H R + Sbjct: 114 PAPLKLISAMKGSREKHGGSQVKLNVKWASDVYDPIPTLLSHTVRSNKKQQ 164 Score = 32.7 bits (73), Expect(2) = 3e-08 Identities = 16/40 (40%), Positives = 26/40 (65%) Frame = +3 Query: 519 KQVQKYGGSSNKCFKTLEDNEKLVGSPSTATDHLAKTKTD 638 KQV+K GG+S C+K+++ +K++G+ ST D L D Sbjct: 193 KQVRKLGGTSGLCYKSMDSCDKVLGA-STELDALEVRSQD 231 >emb|CAH59737.1| hypothetical protein [Plantago major] Length = 196 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/56 (53%), Positives = 38/56 (67%), Gaps = 3/56 (5%) Frame = +2 Query: 350 ESPKHSPM---TWPSDKKLVSAFKGSREKEGLLETKVCVTWAPDVYDPPPTSDDHL 508 ESP P + P+ KLVS+ KGSREK+G+ K+ V+WAPDVYDP PTS H+ Sbjct: 136 ESPNRCPSRCNSLPTPSKLVSSLKGSREKQGMPPKKLSVSWAPDVYDPVPTSVSHV 191 >ref|XP_002531334.1| conserved hypothetical protein [Ricinus communis] gi|223529056|gb|EEF31041.1| conserved hypothetical protein [Ricinus communis] Length = 234 Score = 49.3 bits (116), Expect(2) = 6e-07 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = +2 Query: 395 LVSAFKGSREKEGLLETKVCVTWAPDVYDPPPTSDDH 505 LVSA KGSREK G K+ V+WAPDVYDP P S H Sbjct: 99 LVSAMKGSREKLGASLRKLTVSWAPDVYDPIPNSLSH 135 Score = 30.0 bits (66), Expect(2) = 6e-07 Identities = 13/24 (54%), Positives = 19/24 (79%) Frame = +3 Query: 510 KDKKQVQKYGGSSNKCFKTLEDNE 581 KDKKQ++K GG S++ +KTL +E Sbjct: 175 KDKKQLRKAGGRSDRGYKTLSISE 198