BLASTX nr result
ID: Panax21_contig00023062
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00023062 (509 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q6V9I6.1|HDT1_SOLCH RecName: Full=Histone deacetylase HDT1; A... 64 2e-08 gb|ACZ54946.1| type 2 histone deacetylase b [Nicotiana tabacum] 60 1e-07 gb|ACZ54947.1| type 2 histone deacetylase c [Nicotiana tabacum] 59 4e-07 gb|ACZ54945.1| type 2 histone deacetylase a [Nicotiana tabacum] 58 7e-07 gb|AFK47689.1| unknown [Lotus japonicus] 57 1e-06 >sp|Q6V9I6.1|HDT1_SOLCH RecName: Full=Histone deacetylase HDT1; AltName: Full=Histone deacetylase 2a; Short=HD2a; AltName: Full=ScHD2a gi|33667906|gb|AAQ24532.1| histone deacetylase [Solanum chacoense] Length = 269 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +3 Query: 6 NKSNLQTPKSEGSHYCKSCNRSFKSETALDSHNKAKHIAGK 128 +K +TPKS GSH+CK CNRSF SE ALDSH+KAKH AGK Sbjct: 229 SKQASKTPKSAGSHHCKPCNRSFGSEGALDSHSKAKHSAGK 269 >gb|ACZ54946.1| type 2 histone deacetylase b [Nicotiana tabacum] Length = 294 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = +3 Query: 3 ANKSNLQTPKSEGSHYCKSCNRSFKSETALDSHNKAKHIAGK 128 ANK N QTPKS G+H CK+CNR F SE AL+SH+KAKH A K Sbjct: 254 ANK-NQQTPKSGGAHLCKTCNRGFGSENALESHSKAKHSAAK 294 >gb|ACZ54947.1| type 2 histone deacetylase c [Nicotiana tabacum] Length = 282 Score = 58.9 bits (141), Expect = 4e-07 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +3 Query: 6 NKSNLQTPKSEGSHYCKSCNRSFKSETALDSHNKAKHIAGK 128 NKSN QTPKS GS CK+C+R+F SETAL+SH+KAKH GK Sbjct: 243 NKSN-QTPKSGGSLACKTCSRTFGSETALESHSKAKHSVGK 282 >gb|ACZ54945.1| type 2 histone deacetylase a [Nicotiana tabacum] Length = 295 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = +3 Query: 3 ANKSNLQTPKSEGSHYCKSCNRSFKSETALDSHNKAKHIAGK 128 ANK N QTPKS G+H CK+CNR F SE AL+ H+KAKH A K Sbjct: 255 ANK-NQQTPKSGGAHLCKTCNRGFGSENALEFHSKAKHSAAK 295 >gb|AFK47689.1| unknown [Lotus japonicus] Length = 315 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = +3 Query: 21 QTPKSEGSHYCKSCNRSFKSETALDSHNKAKHIAGK 128 QTPKS G + CK CNRSFK+E AL SHNKAKH A K Sbjct: 280 QTPKSGGEYSCKPCNRSFKTEDALGSHNKAKHSAAK 315