BLASTX nr result
ID: Panax21_contig00022595
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00022595 (449 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI19688.3| unnamed protein product [Vitis vinifera] 70 2e-10 ref|XP_002281492.1| PREDICTED: uncharacterized protein LOC100267... 70 2e-10 ref|XP_002510376.1| conserved hypothetical protein [Ricinus comm... 63 3e-08 ref|XP_002332469.1| predicted protein [Populus trichocarpa] gi|2... 59 4e-07 ref|XP_002865494.1| hypothetical protein ARALYDRAFT_494763 [Arab... 57 2e-06 >emb|CBI19688.3| unnamed protein product [Vitis vinifera] Length = 912 Score = 70.1 bits (170), Expect = 2e-10 Identities = 27/48 (56%), Positives = 39/48 (81%) Frame = -3 Query: 183 DAAENLLKMLERNIKNTDPNVNCMWDFGWNEVMFTYVETDDIIKDVDR 40 DAA+ L KMLE +++ DP+VNC+WD GWN+ MF ++E DD+I+DV+R Sbjct: 844 DAADYLPKMLELDVQTMDPDVNCLWDLGWNDKMFAFIEKDDVIRDVER 891 >ref|XP_002281492.1| PREDICTED: uncharacterized protein LOC100267647 [Vitis vinifera] Length = 1088 Score = 70.1 bits (170), Expect = 2e-10 Identities = 27/48 (56%), Positives = 39/48 (81%) Frame = -3 Query: 183 DAAENLLKMLERNIKNTDPNVNCMWDFGWNEVMFTYVETDDIIKDVDR 40 DAA+ L KMLE +++ DP+VNC+WD GWN+ MF ++E DD+I+DV+R Sbjct: 1020 DAADYLPKMLELDVQTMDPDVNCLWDLGWNDKMFAFIEKDDVIRDVER 1067 >ref|XP_002510376.1| conserved hypothetical protein [Ricinus communis] gi|223551077|gb|EEF52563.1| conserved hypothetical protein [Ricinus communis] Length = 955 Score = 62.8 bits (151), Expect = 3e-08 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = -3 Query: 168 LLKMLERNIKNTDPNVNCMWDFGWNEVMFTYVETDDIIKDVDR 40 L KMLE ++ + DP+VNCMWD GW+E+MFT +E DDII+ V++ Sbjct: 892 LPKMLENDVYSKDPDVNCMWDIGWHEMMFTCIEKDDIIRGVEK 934 >ref|XP_002332469.1| predicted protein [Populus trichocarpa] gi|222832542|gb|EEE71019.1| predicted protein [Populus trichocarpa] Length = 982 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/51 (49%), Positives = 38/51 (74%), Gaps = 1/51 (1%) Frame = -3 Query: 189 CSDAAENLL-KMLERNIKNTDPNVNCMWDFGWNEVMFTYVETDDIIKDVDR 40 C E+ L KMLE ++ N D +VNCMWD GW+++MF ++E DD+I+DV++ Sbjct: 914 CLTPVEDYLPKMLECDVYNWDIDVNCMWDCGWDKMMFAFLEKDDVIRDVEK 964 >ref|XP_002865494.1| hypothetical protein ARALYDRAFT_494763 [Arabidopsis lyrata subsp. lyrata] gi|297311329|gb|EFH41753.1| hypothetical protein ARALYDRAFT_494763 [Arabidopsis lyrata subsp. lyrata] Length = 806 Score = 57.0 bits (136), Expect = 2e-06 Identities = 19/40 (47%), Positives = 32/40 (80%) Frame = -3 Query: 159 MLERNIKNTDPNVNCMWDFGWNEVMFTYVETDDIIKDVDR 40 +LER++ + DPN+N MWD GWN+ M ++E DD+++D++R Sbjct: 750 VLERDVHHKDPNLNSMWDMGWNDSMVAFIEKDDVMRDIER 789