BLASTX nr result
ID: Panax21_contig00022256
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00022256 (455 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003634306.1| PREDICTED: zinc finger CCCH domain-containin... 58 9e-07 ref|XP_002277300.1| PREDICTED: zinc finger CCCH domain-containin... 58 9e-07 >ref|XP_003634306.1| PREDICTED: zinc finger CCCH domain-containing protein 43 isoform 2 [Vitis vinifera] Length = 481 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/44 (63%), Positives = 33/44 (75%), Gaps = 2/44 (4%) Frame = -3 Query: 453 YGICKFGPACKYNHPVTYGNSASS-SIGTGPGQ-PQYGNSTIAD 328 YGICKFGPACK++HPV YGNSAS+ S +G Q P +G S AD Sbjct: 420 YGICKFGPACKFDHPVNYGNSASAPSAESGQDQPPPFGGSVTAD 463 >ref|XP_002277300.1| PREDICTED: zinc finger CCCH domain-containing protein 43 isoform 1 [Vitis vinifera] gi|297733636|emb|CBI14883.3| unnamed protein product [Vitis vinifera] Length = 484 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/44 (63%), Positives = 33/44 (75%), Gaps = 2/44 (4%) Frame = -3 Query: 453 YGICKFGPACKYNHPVTYGNSASS-SIGTGPGQ-PQYGNSTIAD 328 YGICKFGPACK++HPV YGNSAS+ S +G Q P +G S AD Sbjct: 423 YGICKFGPACKFDHPVNYGNSASAPSAESGQDQPPPFGGSVTAD 466