BLASTX nr result
ID: Panax21_contig00021893
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00021893 (979 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518930.1| Glucan endo-1,3-beta-glucosidase precursor, ... 65 2e-08 gb|AFU52666.1| putative PD beta-1,3-glucanase 2 [Solanum tuberosum] 65 2e-08 pir||S31196 hypothetical protein - potato 65 2e-08 gb|ADW08745.1| 1,3-beta-D-glucanase GH17_65 [Populus tremula x P... 65 2e-08 ref|XP_002317055.1| predicted protein [Populus trichocarpa] gi|2... 65 2e-08 >ref|XP_002518930.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis] gi|223541917|gb|EEF43463.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis] Length = 405 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -2 Query: 444 CISQILNFHVKMGSPFLINAYVFFAYKGNLKQVLLDYVLY 325 C++ ILNFHVK GSPFLINAY +FAYK N KQV LD+VL+ Sbjct: 180 CVTPILNFHVKTGSPFLINAYPYFAYKANPKQVSLDFVLF 219 >gb|AFU52666.1| putative PD beta-1,3-glucanase 2 [Solanum tuberosum] Length = 417 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = -2 Query: 444 CISQILNFHVKMGSPFLINAYVFFAYKGNLKQVLLDYVLY 325 C++QI++FH K GSPFLINAY +FAYKGN KQV LD+VL+ Sbjct: 184 CVTQIVDFHCKTGSPFLINAYPYFAYKGNPKQVSLDFVLF 223 >pir||S31196 hypothetical protein - potato Length = 402 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = -2 Query: 444 CISQILNFHVKMGSPFLINAYVFFAYKGNLKQVLLDYVLY 325 C++QI++FH K GSPFLINAY +FAYKGN KQV LD+VL+ Sbjct: 186 CVTQIVDFHCKTGSPFLINAYPYFAYKGNPKQVSLDFVLF 225 >gb|ADW08745.1| 1,3-beta-D-glucanase GH17_65 [Populus tremula x Populus tremuloides] Length = 411 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -2 Query: 447 GCISQILNFHVKMGSPFLINAYVFFAYKGNLKQVLLDYVLY 325 GCI+ ILNFH K SPFLINAY FFAYK N KQ+ LD+VL+ Sbjct: 181 GCITPILNFHAKTNSPFLINAYPFFAYKSNPKQISLDFVLF 221 >ref|XP_002317055.1| predicted protein [Populus trichocarpa] gi|222860120|gb|EEE97667.1| predicted protein [Populus trichocarpa] Length = 341 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -2 Query: 447 GCISQILNFHVKMGSPFLINAYVFFAYKGNLKQVLLDYVLY 325 GCI+ ILNFH K SPFLINAY FFAYK N KQ+ LD+VL+ Sbjct: 158 GCITPILNFHAKTNSPFLINAYPFFAYKSNPKQISLDFVLF 198