BLASTX nr result
ID: Panax21_contig00021849
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00021849 (392 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002332385.1| cytochrome P450 [Populus trichocarpa] gi|222... 79 3e-13 ref|XP_002285021.1| PREDICTED: cytochrome P450 734A1-like [Vitis... 74 9e-12 ref|XP_002524439.1| cytochrome P450, putative [Ricinus communis]... 74 9e-12 ref|XP_003549781.1| PREDICTED: cytochrome P450 734A1-like [Glyci... 74 2e-11 emb|CBI28155.3| unnamed protein product [Vitis vinifera] 74 2e-11 >ref|XP_002332385.1| cytochrome P450 [Populus trichocarpa] gi|222832209|gb|EEE70686.1| cytochrome P450 [Populus trichocarpa] Length = 518 Score = 79.3 bits (194), Expect = 3e-13 Identities = 36/42 (85%), Positives = 41/42 (97%) Frame = -1 Query: 392 TLAIILQRFSFQLSPQYQHAPTVLMLLYPQYGAPIIFRHLSD 267 TLAI+LQRFSF+L+P YQHAPTVLMLLYPQYGAPIIF+HLS+ Sbjct: 476 TLAILLQRFSFRLAPSYQHAPTVLMLLYPQYGAPIIFQHLSN 517 >ref|XP_002285021.1| PREDICTED: cytochrome P450 734A1-like [Vitis vinifera] Length = 527 Score = 74.3 bits (181), Expect = 9e-12 Identities = 39/47 (82%), Positives = 40/47 (85%) Frame = -1 Query: 389 LAIILQRFSFQLSPQYQHAPTVLMLLYPQYGAPIIFRHLSDTHDQRS 249 LAIILQRFSF L+P YQHAPTVLMLLYPQYGAPI FR LS T DQ S Sbjct: 482 LAIILQRFSFTLAPSYQHAPTVLMLLYPQYGAPITFRTLS-TPDQGS 527 >ref|XP_002524439.1| cytochrome P450, putative [Ricinus communis] gi|223536227|gb|EEF37879.1| cytochrome P450, putative [Ricinus communis] Length = 529 Score = 74.3 bits (181), Expect = 9e-12 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -1 Query: 392 TLAIILQRFSFQLSPQYQHAPTVLMLLYPQYGAPIIFRHL 273 TLAI+LQRFSF+L+P YQHAPTVLMLLYPQYGAPIIF+ L Sbjct: 481 TLAILLQRFSFRLAPTYQHAPTVLMLLYPQYGAPIIFKRL 520 >ref|XP_003549781.1| PREDICTED: cytochrome P450 734A1-like [Glycine max] Length = 517 Score = 73.6 bits (179), Expect = 2e-11 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = -1 Query: 389 LAIILQRFSFQLSPQYQHAPTVLMLLYPQYGAPIIFRHLSDT 264 LAIILQRFSF+L+P YQHAPTVLMLLYPQYGAPIIF+ S + Sbjct: 474 LAIILQRFSFRLAPSYQHAPTVLMLLYPQYGAPIIFQQFSQS 515 >emb|CBI28155.3| unnamed protein product [Vitis vinifera] Length = 542 Score = 73.6 bits (179), Expect = 2e-11 Identities = 38/45 (84%), Positives = 39/45 (86%) Frame = -1 Query: 389 LAIILQRFSFQLSPQYQHAPTVLMLLYPQYGAPIIFRHLSDTHDQ 255 LAIILQRFSF L+P YQHAPTVLMLLYPQYGAPI FR LS T DQ Sbjct: 469 LAIILQRFSFTLAPSYQHAPTVLMLLYPQYGAPITFRTLS-TPDQ 512