BLASTX nr result
ID: Panax21_contig00021808
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00021808 (537 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN74732.1| hypothetical protein VITISV_037838 [Vitis vinifera] 75 6e-12 ref|XP_002268715.1| PREDICTED: uncharacterized protein At3g49720... 74 1e-11 ref|XP_002510039.1| conserved hypothetical protein [Ricinus comm... 74 2e-11 ref|XP_002302381.1| predicted protein [Populus trichocarpa] gi|2... 72 7e-11 ref|XP_002264014.2| PREDICTED: uncharacterized protein At3g49720... 70 2e-10 >emb|CAN74732.1| hypothetical protein VITISV_037838 [Vitis vinifera] Length = 256 Score = 75.1 bits (183), Expect = 6e-12 Identities = 36/51 (70%), Positives = 43/51 (84%) Frame = -3 Query: 154 SFSSTDKVTILPMFVGDFTCTYEVQRAMPILKKAYGDSMHKVLHVGPETCS 2 S+S +D + + M VGDF+CT EVQRA+PILKKAYGDSM KVLHVGP+TCS Sbjct: 50 SYSGSD--SNMSMHVGDFSCTLEVQRAIPILKKAYGDSMRKVLHVGPDTCS 98 >ref|XP_002268715.1| PREDICTED: uncharacterized protein At3g49720 [Vitis vinifera] Length = 199 Score = 73.9 bits (180), Expect = 1e-11 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -3 Query: 124 LPMFVGDFTCTYEVQRAMPILKKAYGDSMHKVLHVGPETCS 2 + M VGDF+CT EVQRA+PILKKAYGDSM KVLHVGP+TCS Sbjct: 1 MSMHVGDFSCTLEVQRAIPILKKAYGDSMRKVLHVGPDTCS 41 >ref|XP_002510039.1| conserved hypothetical protein [Ricinus communis] gi|223550740|gb|EEF52226.1| conserved hypothetical protein [Ricinus communis] Length = 256 Score = 73.6 bits (179), Expect = 2e-11 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = -3 Query: 136 KVTILPMFVGDFTCTYEVQRAMPILKKAYGDSMHKVLHVGPETCS 2 K+ GDF+CT EVQRA+P+LKKAYGDSMHKVLHVGP+TCS Sbjct: 54 KIGAFSRIEGDFSCTVEVQRAIPVLKKAYGDSMHKVLHVGPDTCS 98 >ref|XP_002302381.1| predicted protein [Populus trichocarpa] gi|222844107|gb|EEE81654.1| predicted protein [Populus trichocarpa] Length = 264 Score = 71.6 bits (174), Expect = 7e-11 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -3 Query: 115 FVGDFTCTYEVQRAMPILKKAYGDSMHKVLHVGPETCS 2 + GDF+CT EVQ A+PILKKAYGDSMHKVLH+GP TCS Sbjct: 69 YAGDFSCTVEVQEAIPILKKAYGDSMHKVLHIGPNTCS 106 >ref|XP_002264014.2| PREDICTED: uncharacterized protein At3g49720-like [Vitis vinifera] Length = 203 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 109 GDFTCTYEVQRAMPILKKAYGDSMHKVLHVGPETCS 2 GDF+CT EVQRA+PILKKAYGDSM KVLHVGP+TCS Sbjct: 69 GDFSCTLEVQRAIPILKKAYGDSMRKVLHVGPDTCS 104