BLASTX nr result
ID: Panax21_contig00021384
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00021384 (485 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527362.1| E3 ubiquitin protein ligase upl2, putative [... 73 3e-11 ref|XP_003527888.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-... 71 8e-11 ref|XP_002301117.1| predicted protein [Populus trichocarpa] gi|2... 71 1e-10 ref|XP_004163452.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin... 70 1e-10 ref|XP_004152744.1| PREDICTED: E3 ubiquitin-protein ligase UPL2-... 70 1e-10 >ref|XP_002527362.1| E3 ubiquitin protein ligase upl2, putative [Ricinus communis] gi|223533281|gb|EEF35034.1| E3 ubiquitin protein ligase upl2, putative [Ricinus communis] Length = 3666 Score = 72.8 bits (177), Expect = 3e-11 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -1 Query: 134 SMYSAASPVIQWYWEVAQGFSKEDKARLLQFVTGTSK 24 S YSAASPVIQW+WEV QGFSKEDKARLLQFVTGTSK Sbjct: 3561 SGYSAASPVIQWFWEVVQGFSKEDKARLLQFVTGTSK 3597 Score = 55.5 bits (132), Expect = 4e-06 Identities = 31/47 (65%), Positives = 36/47 (76%) Frame = -2 Query: 214 NDISDILDLTFSIDADEEKLILYERAQVCTVQHLLLSSGIGRLLKVS 74 NDISD+LDLTFSIDADEEKLILYER +V H L+ GR +KV+ Sbjct: 3449 NDISDVLDLTFSIDADEEKLILYERTEV--TDHELIPG--GRNIKVT 3491 >ref|XP_003527888.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-like [Glycine max] Length = 3654 Score = 71.2 bits (173), Expect = 8e-11 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -1 Query: 134 SMYSAASPVIQWYWEVAQGFSKEDKARLLQFVTGTSK 24 S YS ASPVIQW+WEV QGFSKEDKARLLQFVTGTSK Sbjct: 3549 SGYSGASPVIQWFWEVVQGFSKEDKARLLQFVTGTSK 3585 >ref|XP_002301117.1| predicted protein [Populus trichocarpa] gi|222842843|gb|EEE80390.1| predicted protein [Populus trichocarpa] Length = 471 Score = 70.9 bits (172), Expect = 1e-10 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -1 Query: 134 SMYSAASPVIQWYWEVAQGFSKEDKARLLQFVTGTSK 24 S YS ASPVIQW+WEV QGFSKEDKARLLQFVTGTSK Sbjct: 366 SGYSPASPVIQWFWEVVQGFSKEDKARLLQFVTGTSK 402 >ref|XP_004163452.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase UPL2-like [Cucumis sativus] Length = 3666 Score = 70.5 bits (171), Expect = 1e-10 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -1 Query: 134 SMYSAASPVIQWYWEVAQGFSKEDKARLLQFVTGTSK 24 S YSAASPVIQW+WEV Q FSKEDKARLLQFVTGTSK Sbjct: 3561 SGYSAASPVIQWFWEVVQSFSKEDKARLLQFVTGTSK 3597 >ref|XP_004152744.1| PREDICTED: E3 ubiquitin-protein ligase UPL2-like [Cucumis sativus] Length = 3656 Score = 70.5 bits (171), Expect = 1e-10 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -1 Query: 134 SMYSAASPVIQWYWEVAQGFSKEDKARLLQFVTGTSK 24 S YSAASPVIQW+WEV Q FSKEDKARLLQFVTGTSK Sbjct: 3551 SGYSAASPVIQWFWEVVQSFSKEDKARLLQFVTGTSK 3587