BLASTX nr result
ID: Panax21_contig00021373
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00021373 (452 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509523.1| sulfite reductase, putative [Ricinus communi... 72 5e-11 ref|XP_002300104.1| predicted protein [Populus trichocarpa] gi|2... 72 5e-11 gb|ABB86275.1| sulfite oxidase-like [Solanum tuberosum] 71 8e-11 ref|NP_001234681.1| sulfite oxidase [Solanum lycopersicum] gi|11... 71 8e-11 ref|NP_001030620.1| sulfite oxidase [Arabidopsis thaliana] gi|33... 70 1e-10 >ref|XP_002509523.1| sulfite reductase, putative [Ricinus communis] gi|223549422|gb|EEF50910.1| sulfite reductase, putative [Ricinus communis] Length = 393 Score = 72.0 bits (175), Expect = 5e-11 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +1 Query: 307 FFMQKDYKIFPPGVNWENTNWSTRRPQMDFPVQ 405 FFMQKDYK+FPP VNW+N NWSTRRPQMDFPVQ Sbjct: 235 FFMQKDYKMFPPSVNWDNINWSTRRPQMDFPVQ 267 >ref|XP_002300104.1| predicted protein [Populus trichocarpa] gi|222847362|gb|EEE84909.1| predicted protein [Populus trichocarpa] Length = 393 Score = 72.0 bits (175), Expect = 5e-11 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +1 Query: 307 FFMQKDYKIFPPGVNWENTNWSTRRPQMDFPVQ 405 FFMQKDYK+FPP VNW+N NWSTRRPQMDFPVQ Sbjct: 235 FFMQKDYKMFPPSVNWDNINWSTRRPQMDFPVQ 267 >gb|ABB86275.1| sulfite oxidase-like [Solanum tuberosum] Length = 393 Score = 71.2 bits (173), Expect = 8e-11 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +1 Query: 307 FFMQKDYKIFPPGVNWENTNWSTRRPQMDFPVQ 405 FFMQKDYK+FPP VNW+N NWSTRRPQMDFPVQ Sbjct: 235 FFMQKDYKMFPPTVNWDNINWSTRRPQMDFPVQ 267 >ref|NP_001234681.1| sulfite oxidase [Solanum lycopersicum] gi|114186917|gb|ABI53846.1| sulfite oxidase [Solanum lycopersicum] Length = 393 Score = 71.2 bits (173), Expect = 8e-11 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +1 Query: 307 FFMQKDYKIFPPGVNWENTNWSTRRPQMDFPVQ 405 FFMQKDYK+FPP VNW+N NWSTRRPQMDFPVQ Sbjct: 235 FFMQKDYKMFPPTVNWDNINWSTRRPQMDFPVQ 267 >ref|NP_001030620.1| sulfite oxidase [Arabidopsis thaliana] gi|332640212|gb|AEE73733.1| sulfite oxidase [Arabidopsis thaliana] Length = 298 Score = 70.5 bits (171), Expect = 1e-10 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 307 FFMQKDYKIFPPGVNWENTNWSTRRPQMDFPVQ 405 FFMQKDYK+FPP VNW+N NWS+RRPQMDFPVQ Sbjct: 140 FFMQKDYKMFPPSVNWDNINWSSRRPQMDFPVQ 172