BLASTX nr result
ID: Panax21_contig00021353
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00021353 (411 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002305605.1| predicted protein [Populus trichocarpa] gi|2... 105 3e-21 ref|XP_002518527.1| pentatricopeptide repeat-containing protein,... 105 4e-21 ref|XP_002264956.1| PREDICTED: pentatricopeptide repeat-containi... 97 1e-18 gb|AFV70831.1| tetratricopeptide repeat-like superfamily protein... 60 1e-07 gb|AFV70830.1| tetratricopeptide repeat-like superfamily protein... 60 1e-07 >ref|XP_002305605.1| predicted protein [Populus trichocarpa] gi|222848569|gb|EEE86116.1| predicted protein [Populus trichocarpa] Length = 564 Score = 105 bits (263), Expect = 3e-21 Identities = 47/90 (52%), Positives = 66/90 (73%) Frame = -2 Query: 392 QNLNLSTKLTPYIFLQVLHKT*TNPQISLNFFNWSKKNLGFQPDLRTQCKLAQTLIRFGM 213 QN NLSTKLTP +F Q+LHKT TNPQISL FFNW + NL +PDL++QC + + G+ Sbjct: 42 QNFNLSTKLTPPLFNQILHKTQTNPQISLRFFNWVQTNLKLKPDLKSQCHIINICVNSGL 101 Query: 212 SQPARPILDSLIRTHPPAQIVDSLFVSCKG 123 + P RPI+DSL++TH + + +++ SC+G Sbjct: 102 TLPVRPIMDSLVKTHHVSVLGEAMVDSCRG 131 >ref|XP_002518527.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223542372|gb|EEF43914.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 599 Score = 105 bits (262), Expect = 4e-21 Identities = 47/90 (52%), Positives = 68/90 (75%) Frame = -2 Query: 392 QNLNLSTKLTPYIFLQVLHKT*TNPQISLNFFNWSKKNLGFQPDLRTQCKLAQTLIRFGM 213 QNLNLS+KLTP++F Q+LHKT T+ QISLNFFNW+K NL F PDL++QC + Q + + Sbjct: 71 QNLNLSSKLTPFLFFQILHKTQTHAQISLNFFNWAKTNLNFNPDLKSQCHVIQLSLGSDL 130 Query: 212 SQPARPILDSLIRTHPPAQIVDSLFVSCKG 123 + A+ ILDSLI+T+P ++++ +C+G Sbjct: 131 PRAAKKILDSLIKTYPSNLFLETMVQACRG 160 >ref|XP_002264956.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21170-like [Vitis vinifera] Length = 569 Score = 97.1 bits (240), Expect = 1e-18 Identities = 47/90 (52%), Positives = 64/90 (71%) Frame = -2 Query: 392 QNLNLSTKLTPYIFLQVLHKT*TNPQISLNFFNWSKKNLGFQPDLRTQCKLAQTLIRFGM 213 +N NLS+KLTP +F Q+L KT NPQ SL+FFNW + NLGFQPDL ++ + I+ G+ Sbjct: 50 RNFNLSSKLTPSLFHQILLKTQKNPQSSLSFFNWVRTNLGFQPDLAAHSQIIRISIQSGL 109 Query: 212 SQPARPILDSLIRTHPPAQIVDSLFVSCKG 123 QPA+ ILDSLI T + +VDS+ +C+G Sbjct: 110 FQPAKGILDSLIETQKVSVLVDSVIQACRG 139 >gb|AFV70831.1| tetratricopeptide repeat-like superfamily protein, partial [Arabidopsis halleri] Length = 186 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/89 (33%), Positives = 54/89 (60%) Frame = -2 Query: 407 MNYHNQNLNLSTKLTPYIFLQVLHKT*TNPQISLNFFNWSKKNLGFQPDLRTQCKLAQTL 228 + Y L+ ST +P IFLQ+L +T P+ +L+FF+++K +L F PDL++ C++ + Sbjct: 42 LQYVKSKLSRSTLTSP-IFLQILRETRKCPKTTLDFFDFAKTHLRFDPDLKSHCRVIEVA 100 Query: 227 IRFGMSQPARPILDSLIRTHPPAQIVDSL 141 G+ + A +L L+ TH + +V S+ Sbjct: 101 TESGLLERAETLLRPLVETHSVSLVVGSM 129 >gb|AFV70830.1| tetratricopeptide repeat-like superfamily protein, partial [Arabidopsis halleri] Length = 186 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/89 (33%), Positives = 54/89 (60%) Frame = -2 Query: 407 MNYHNQNLNLSTKLTPYIFLQVLHKT*TNPQISLNFFNWSKKNLGFQPDLRTQCKLAQTL 228 + Y L+ ST +P IFLQ+L +T P+ +L+FF+++K +L F PDL++ C++ + Sbjct: 42 LQYVKSKLSRSTLTSP-IFLQILRETRKCPKTTLDFFDFAKTHLRFDPDLKSHCRVIEVA 100 Query: 227 IRFGMSQPARPILDSLIRTHPPAQIVDSL 141 G+ + A +L L+ TH + +V S+ Sbjct: 101 TESGLLERAETLLRPLVETHSVSLVVGSM 129