BLASTX nr result
ID: Panax21_contig00021262
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00021262 (435 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004136035.1| PREDICTED: mismatch repair endonuclease PMS2... 58 9e-07 ref|XP_003536886.1| PREDICTED: mismatch repair endonuclease PMS2... 57 1e-06 ref|XP_003520235.1| PREDICTED: mismatch repair endonuclease PMS2... 57 1e-06 emb|CBI36837.3| unnamed protein product [Vitis vinifera] 57 2e-06 ref|XP_002267393.1| PREDICTED: mismatch repair endonuclease PMS2... 57 2e-06 >ref|XP_004136035.1| PREDICTED: mismatch repair endonuclease PMS2-like [Cucumis sativus] gi|449498483|ref|XP_004160549.1| PREDICTED: mismatch repair endonuclease PMS2-like [Cucumis sativus] Length = 921 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 47 ECLMIGCYKMDTPDSVCPPRVRSMLASRACRSS 145 EC +IG Y+MDT DSVCP RVR+MLASRACRSS Sbjct: 835 ECSIIGSYRMDTADSVCPSRVRAMLASRACRSS 867 >ref|XP_003536886.1| PREDICTED: mismatch repair endonuclease PMS2-like [Glycine max] Length = 944 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +2 Query: 47 ECLMIGCYKMDTPDSVCPPRVRSMLASRACRSS 145 EC ++G YK+DT DSVCP RVR+MLASRACRSS Sbjct: 858 ECSIVGSYKLDTSDSVCPSRVRAMLASRACRSS 890 >ref|XP_003520235.1| PREDICTED: mismatch repair endonuclease PMS2-like [Glycine max] Length = 1036 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +2 Query: 47 ECLMIGCYKMDTPDSVCPPRVRSMLASRACRSS 145 EC ++G YK+DT DSVCP RVR+MLASRACRSS Sbjct: 860 ECSIVGSYKLDTSDSVCPSRVRAMLASRACRSS 892 >emb|CBI36837.3| unnamed protein product [Vitis vinifera] Length = 854 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +2 Query: 47 ECLMIGCYKMDTPDSVCPPRVRSMLASRACRSS 145 EC ++G YKMDT DS+CP RVR+MLASRACRSS Sbjct: 755 ECSILGTYKMDTCDSICPSRVRAMLASRACRSS 787 >ref|XP_002267393.1| PREDICTED: mismatch repair endonuclease PMS2-like [Vitis vinifera] Length = 937 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +2 Query: 47 ECLMIGCYKMDTPDSVCPPRVRSMLASRACRSS 145 EC ++G YKMDT DS+CP RVR+MLASRACRSS Sbjct: 838 ECSILGTYKMDTCDSICPSRVRAMLASRACRSS 870