BLASTX nr result
ID: Panax21_contig00021227
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00021227 (614 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEY75220.1| cytochrome P450 CYP82H23, partial [Panax ginseng] 74 3e-11 gb|AAS90126.1| cytochrome P450 [Ammi majus] 55 1e-05 >gb|AEY75220.1| cytochrome P450 CYP82H23, partial [Panax ginseng] Length = 245 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 612 KRETLSINESEHDFIHVMQSVMDGSQFTEHDTDKAI 505 KRETLSINESEHDFIH MQSVMDGSQFTEHDTDKAI Sbjct: 210 KRETLSINESEHDFIHGMQSVMDGSQFTEHDTDKAI 245 >gb|AAS90126.1| cytochrome P450 [Ammi majus] Length = 530 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = -3 Query: 612 KRETLSINESEHDFIHVMQSVMDGSQFTEHDTDKAIKGTCL 490 KR +S N SE DFI+VM S MDG+QF DTD AIKGTCL Sbjct: 283 KRTNISNNHSEDDFIYVMLSAMDGNQFPGIDTDTAIKGTCL 323