BLASTX nr result
ID: Panax21_contig00021049
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00021049 (791 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004142658.1| PREDICTED: RNA exonuclease 4-like [Cucumis s... 65 2e-08 ref|XP_002524814.1| exonuclease, putative [Ricinus communis] gi|... 65 2e-08 ref|XP_002302830.1| predicted protein [Populus trichocarpa] gi|2... 59 2e-06 >ref|XP_004142658.1| PREDICTED: RNA exonuclease 4-like [Cucumis sativus] gi|449507969|ref|XP_004163181.1| PREDICTED: RNA exonuclease 4-like [Cucumis sativus] Length = 350 Score = 65.1 bits (157), Expect = 2e-08 Identities = 35/66 (53%), Positives = 43/66 (65%), Gaps = 1/66 (1%) Frame = -3 Query: 789 RMRSQDHPVEV-TGTLTAKCYLAVTNIFNSFQPMDLEKMTPDELFETSKSNYKCWCLDSS 613 RMRS DH +V T ++T C V +S DLEKMTPDEL+E S+SN+KCWC D S Sbjct: 286 RMRSLDHHRQVMTLSITPSCIQYVAPNLDSHSAKDLEKMTPDELYEMSRSNFKCWCHD-S 344 Query: 612 REAMET 595 R M+T Sbjct: 345 RRVMQT 350 >ref|XP_002524814.1| exonuclease, putative [Ricinus communis] gi|223535998|gb|EEF37657.1| exonuclease, putative [Ricinus communis] Length = 365 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/58 (51%), Positives = 39/58 (67%) Frame = -3 Query: 789 RMRSQDHPVEVTGTLTAKCYLAVTNIFNSFQPMDLEKMTPDELFETSKSNYKCWCLDS 616 RMR QDH VE +G ++ F+S +P +LE MT DEL++ S+SNYKCWCLDS Sbjct: 308 RMRGQDHEVEQSGLR------GISGSFDSLKPKELESMTSDELYDISRSNYKCWCLDS 359 >ref|XP_002302830.1| predicted protein [Populus trichocarpa] gi|222844556|gb|EEE82103.1| predicted protein [Populus trichocarpa] Length = 349 Score = 58.5 bits (140), Expect = 2e-06 Identities = 30/59 (50%), Positives = 39/59 (66%) Frame = -3 Query: 789 RMRSQDHPVEVTGTLTAKCYLAVTNIFNSFQPMDLEKMTPDELFETSKSNYKCWCLDSS 613 RMR+QDH + GT + + F S + +LE MTPDEL++ SKS+YKCWCLDSS Sbjct: 290 RMRAQDHQGKGIGTPDSD------SGFESQKAEELENMTPDELYQISKSDYKCWCLDSS 342