BLASTX nr result
ID: Panax21_contig00020752
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00020752 (716 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632676.1| PREDICTED: uncharacterized protein LOC100253... 234 2e-59 emb|CBI29924.3| unnamed protein product [Vitis vinifera] 234 2e-59 emb|CAN83573.1| hypothetical protein VITISV_041710 [Vitis vinifera] 234 2e-59 ref|XP_003624606.1| CCR4-NOT transcription complex subunit [Medi... 231 1e-58 ref|XP_002525444.1| conserved hypothetical protein [Ricinus comm... 227 2e-57 >ref|XP_003632676.1| PREDICTED: uncharacterized protein LOC100253711 [Vitis vinifera] Length = 888 Score = 234 bits (596), Expect = 2e-59 Identities = 105/119 (88%), Positives = 112/119 (94%), Gaps = 1/119 (0%) Frame = +3 Query: 3 PQPKDSERAKNYTPRHPAATPSSYPQGQAPIVNNPTFWERLGADNFGTDTLFFSFYYQQN 182 PQPKDSERA+NYTPRHPA TP SYPQ QAPIVNNP FWERLG D FGTDTLFF+FYYQQN Sbjct: 748 PQPKDSERARNYTPRHPAVTPPSYPQVQAPIVNNPAFWERLGLDTFGTDTLFFAFYYQQN 807 Query: 183 TYQQYLAAKELKKQSWRYHKKYNTWFQRHEEPKVATDDYEQGTYVYFDFHI-SDELQHG 356 TYQQYLAAKELKKQSWRYH+KYNTWFQRHEEPKVATD++EQGTYVYFDFHI +D+LQHG Sbjct: 808 TYQQYLAAKELKKQSWRYHRKYNTWFQRHEEPKVATDEFEQGTYVYFDFHIANDDLQHG 866 >emb|CBI29924.3| unnamed protein product [Vitis vinifera] Length = 897 Score = 234 bits (596), Expect = 2e-59 Identities = 105/119 (88%), Positives = 112/119 (94%), Gaps = 1/119 (0%) Frame = +3 Query: 3 PQPKDSERAKNYTPRHPAATPSSYPQGQAPIVNNPTFWERLGADNFGTDTLFFSFYYQQN 182 PQPKDSERA+NYTPRHPA TP SYPQ QAPIVNNP FWERLG D FGTDTLFF+FYYQQN Sbjct: 757 PQPKDSERARNYTPRHPAVTPPSYPQVQAPIVNNPAFWERLGLDTFGTDTLFFAFYYQQN 816 Query: 183 TYQQYLAAKELKKQSWRYHKKYNTWFQRHEEPKVATDDYEQGTYVYFDFHI-SDELQHG 356 TYQQYLAAKELKKQSWRYH+KYNTWFQRHEEPKVATD++EQGTYVYFDFHI +D+LQHG Sbjct: 817 TYQQYLAAKELKKQSWRYHRKYNTWFQRHEEPKVATDEFEQGTYVYFDFHIANDDLQHG 875 >emb|CAN83573.1| hypothetical protein VITISV_041710 [Vitis vinifera] Length = 214 Score = 234 bits (596), Expect = 2e-59 Identities = 105/119 (88%), Positives = 112/119 (94%), Gaps = 1/119 (0%) Frame = +3 Query: 3 PQPKDSERAKNYTPRHPAATPSSYPQGQAPIVNNPTFWERLGADNFGTDTLFFSFYYQQN 182 PQPKDSERA+NYTPRHPA TP SYPQ QAPIVNNP FWERLG D FGTDTLFF+FYYQQN Sbjct: 74 PQPKDSERARNYTPRHPAVTPPSYPQVQAPIVNNPAFWERLGLDTFGTDTLFFAFYYQQN 133 Query: 183 TYQQYLAAKELKKQSWRYHKKYNTWFQRHEEPKVATDDYEQGTYVYFDFHI-SDELQHG 356 TYQQYLAAKELKKQSWRYH+KYNTWFQRHEEPKVATD++EQGTYVYFDFHI +D+LQHG Sbjct: 134 TYQQYLAAKELKKQSWRYHRKYNTWFQRHEEPKVATDEFEQGTYVYFDFHIANDDLQHG 192 >ref|XP_003624606.1| CCR4-NOT transcription complex subunit [Medicago truncatula] gi|124365585|gb|ABN09819.1| Not CCR4-Not complex component, N-terminal; tRNA-binding arm [Medicago truncatula] gi|355499621|gb|AES80824.1| CCR4-NOT transcription complex subunit [Medicago truncatula] Length = 901 Score = 231 bits (588), Expect = 1e-58 Identities = 104/119 (87%), Positives = 111/119 (93%), Gaps = 1/119 (0%) Frame = +3 Query: 3 PQPKDSERAKNYTPRHPAATPSSYPQGQAPIVNNPTFWERLGADNFGTDTLFFSFYYQQN 182 PQP+DSER + YTPRHPA TPSSYPQ QAPIVNNP FWERLG + FGTDTLFF+FYYQQN Sbjct: 762 PQPRDSERPRTYTPRHPAITPSSYPQVQAPIVNNPAFWERLGLEPFGTDTLFFAFYYQQN 821 Query: 183 TYQQYLAAKELKKQSWRYHKKYNTWFQRHEEPKVATDDYEQGTYVYFDFHI-SDELQHG 356 TYQQYLAAKELKKQSWRYH+KYNTWFQRHEEPKVATDDYEQGTYVYFDFHI +D+LQHG Sbjct: 822 TYQQYLAAKELKKQSWRYHRKYNTWFQRHEEPKVATDDYEQGTYVYFDFHIANDDLQHG 880 >ref|XP_002525444.1| conserved hypothetical protein [Ricinus communis] gi|223535257|gb|EEF36934.1| conserved hypothetical protein [Ricinus communis] Length = 889 Score = 227 bits (579), Expect = 2e-57 Identities = 101/119 (84%), Positives = 112/119 (94%), Gaps = 1/119 (0%) Frame = +3 Query: 3 PQPKDSERAKNYTPRHPAATPSSYPQGQAPIVNNPTFWERLGADNFGTDTLFFSFYYQQN 182 PQPKDSERA++YTPRHP ATP SYPQ QAPIVNNP FWERL D++GTDTLFF+FYYQQN Sbjct: 749 PQPKDSERARSYTPRHPTATPPSYPQVQAPIVNNPAFWERLTIDSYGTDTLFFAFYYQQN 808 Query: 183 TYQQYLAAKELKKQSWRYHKKYNTWFQRHEEPKVATDDYEQGTYVYFDFHI-SDELQHG 356 T+QQYLAAKELKKQSWRYH+KYNTWFQRHEEPK+ATD+YEQGTYVYFDFHI +D+LQHG Sbjct: 809 THQQYLAAKELKKQSWRYHRKYNTWFQRHEEPKIATDEYEQGTYVYFDFHIANDDLQHG 867