BLASTX nr result
ID: Panax21_contig00020739
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00020739 (425 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276076.2| PREDICTED: BTB/POZ domain-containing protein... 85 7e-15 emb|CBI34431.3| unnamed protein product [Vitis vinifera] 85 7e-15 emb|CAN63457.1| hypothetical protein VITISV_008241 [Vitis vinifera] 85 7e-15 ref|XP_002509901.1| atpob1, putative [Ricinus communis] gi|22354... 82 3e-14 gb|ACQ59090.1| BTB/POZ protein [Nicotiana benthamiana] 79 4e-13 >ref|XP_002276076.2| PREDICTED: BTB/POZ domain-containing protein POB1-like [Vitis vinifera] Length = 722 Score = 84.7 bits (208), Expect = 7e-15 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = +1 Query: 205 TRFQEEVLNLPLAGIEAVLSSDDLQVASEDVVYDFVLKWARIH 333 T+FQEEVLNLPLAGIEAVLSSDDLQVASED VYDFVLKWARIH Sbjct: 286 TKFQEEVLNLPLAGIEAVLSSDDLQVASEDAVYDFVLKWARIH 328 >emb|CBI34431.3| unnamed protein product [Vitis vinifera] Length = 516 Score = 84.7 bits (208), Expect = 7e-15 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = +1 Query: 205 TRFQEEVLNLPLAGIEAVLSSDDLQVASEDVVYDFVLKWARIH 333 T+FQEEVLNLPLAGIEAVLSSDDLQVASED VYDFVLKWARIH Sbjct: 338 TKFQEEVLNLPLAGIEAVLSSDDLQVASEDAVYDFVLKWARIH 380 >emb|CAN63457.1| hypothetical protein VITISV_008241 [Vitis vinifera] Length = 526 Score = 84.7 bits (208), Expect = 7e-15 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = +1 Query: 205 TRFQEEVLNLPLAGIEAVLSSDDLQVASEDVVYDFVLKWARIH 333 T+FQEEVLNLPLAGIEAVLSSDDLQVASED VYDFVLKWARIH Sbjct: 255 TKFQEEVLNLPLAGIEAVLSSDDLQVASEDAVYDFVLKWARIH 297 >ref|XP_002509901.1| atpob1, putative [Ricinus communis] gi|223549800|gb|EEF51288.1| atpob1, putative [Ricinus communis] Length = 734 Score = 82.4 bits (202), Expect = 3e-14 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +1 Query: 208 RFQEEVLNLPLAGIEAVLSSDDLQVASEDVVYDFVLKWARIH 333 +FQEEVLNLPLAGIEA+LSSDDLQVASED VYDFVLKWARIH Sbjct: 292 KFQEEVLNLPLAGIEAILSSDDLQVASEDAVYDFVLKWARIH 333 >gb|ACQ59090.1| BTB/POZ protein [Nicotiana benthamiana] Length = 552 Score = 79.0 bits (193), Expect = 4e-13 Identities = 40/53 (75%), Positives = 44/53 (83%), Gaps = 3/53 (5%) Frame = +1 Query: 184 QFLFAIF---TRFQEEVLNLPLAGIEAVLSSDDLQVASEDVVYDFVLKWARIH 333 QFL A + T+FQEEV+ LPLAGIEA+LSSDDLQVASED VYDFVLKW R H Sbjct: 271 QFLAARYKDITKFQEEVMKLPLAGIEAILSSDDLQVASEDAVYDFVLKWTRAH 323