BLASTX nr result
ID: Panax21_contig00020663
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00020663 (531 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD64961.1| hypothetical protein 25.t00068 [Brassica oleracea] 65 5e-09 ref|XP_002865121.1| predicted protein [Arabidopsis lyrata subsp.... 62 5e-08 ref|XP_002534159.1| conserved hypothetical protein [Ricinus comm... 62 5e-08 dbj|BAA97174.1| unnamed protein product [Arabidopsis thaliana] 60 2e-07 ref|NP_199551.2| uncharacterized protein [Arabidopsis thaliana] ... 60 2e-07 >gb|ABD64961.1| hypothetical protein 25.t00068 [Brassica oleracea] Length = 1161 Score = 65.5 bits (158), Expect = 5e-09 Identities = 32/47 (68%), Positives = 38/47 (80%) Frame = -2 Query: 530 NDSELAARVFSLLSPNGVLVSLISAVDSLSLVKYVFPIERFPSTHQF 390 NDS+L+ RVFSLLSP+G+L+S I AVD LSLVKYVFP ER P +F Sbjct: 93 NDSDLSGRVFSLLSPSGILMSSIFAVDKLSLVKYVFPTERLPEYARF 139 >ref|XP_002865121.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297310956|gb|EFH41380.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 1054 Score = 62.0 bits (149), Expect = 5e-08 Identities = 31/56 (55%), Positives = 41/56 (73%) Frame = -2 Query: 530 NDSELAARVFSLLSPNGVLVSLISAVDSLSLVKYVFPIERFPSTHQFNVRNKTKAS 363 ND +LA RVF+LLSP+G+L+S I AVD L+LVKYVFP ER P +F + ++ S Sbjct: 94 NDLDLAERVFNLLSPSGILMSSIFAVDKLALVKYVFPTERLPEYARFMLSSEKDRS 149 >ref|XP_002534159.1| conserved hypothetical protein [Ricinus communis] gi|223525770|gb|EEF28225.1| conserved hypothetical protein [Ricinus communis] Length = 785 Score = 62.0 bits (149), Expect = 5e-08 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -2 Query: 530 NDSELAARVFSLLSPNGVLVSLISAVDSLSLVKYVFPIERFP 405 NDS+LA++VF+LLSPNGV+ ISAVD SLVKYVFP ER P Sbjct: 92 NDSDLASKVFNLLSPNGVVFQSISAVDRQSLVKYVFPTERLP 133 >dbj|BAA97174.1| unnamed protein product [Arabidopsis thaliana] Length = 665 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = -2 Query: 530 NDSELAARVFSLLSPNGVLVSLISAVDSLSLVKYVFPIERFPSTHQF 390 ND +LA RV++LLSP+G+L+S I AVD L+LVKYVFP ER P +F Sbjct: 161 NDLDLAERVYNLLSPSGILMSSIFAVDKLALVKYVFPTERLPEYARF 207 >ref|NP_199551.2| uncharacterized protein [Arabidopsis thaliana] gi|332008123|gb|AED95506.1| uncharacterized protein [Arabidopsis thaliana] Length = 862 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = -2 Query: 530 NDSELAARVFSLLSPNGVLVSLISAVDSLSLVKYVFPIERFPSTHQF 390 ND +LA RV++LLSP+G+L+S I AVD L+LVKYVFP ER P +F Sbjct: 161 NDLDLAERVYNLLSPSGILMSSIFAVDKLALVKYVFPTERLPEYARF 207