BLASTX nr result
ID: Panax21_contig00020649
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00020649 (387 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528672.1| protein binding protein, putative [Ricinus c... 80 1e-13 ref|XP_003523263.1| PREDICTED: E3 ubiquitin-protein ligase RKP-l... 80 2e-13 ref|XP_003602474.1| RING finger and SPRY domain-containing prote... 80 2e-13 gb|AEL98841.1| zinc finger family protein, partial [Silene latif... 77 1e-12 ref|NP_850020.1| ubiquitination-promoting complex protein 1 [Ara... 77 1e-12 >ref|XP_002528672.1| protein binding protein, putative [Ricinus communis] gi|223531895|gb|EEF33711.1| protein binding protein, putative [Ricinus communis] Length = 1348 Score = 80.5 bits (197), Expect = 1e-13 Identities = 38/48 (79%), Positives = 42/48 (87%) Frame = -3 Query: 145 VIFQKLLREACIQDEELLSVFLDRLFNTLSWAMTEFSVSIREIQEKYK 2 V+FQ LLREACI D EL S FL+RLFNTLSW MTEFSVSIRE+QEKY+ Sbjct: 996 VVFQNLLREACINDGELFSAFLNRLFNTLSWTMTEFSVSIREMQEKYQ 1043 >ref|XP_003523263.1| PREDICTED: E3 ubiquitin-protein ligase RKP-like [Glycine max] Length = 1269 Score = 79.7 bits (195), Expect = 2e-13 Identities = 37/48 (77%), Positives = 43/48 (89%) Frame = -3 Query: 145 VIFQKLLREACIQDEELLSVFLDRLFNTLSWAMTEFSVSIREIQEKYK 2 V+FQ+LLREACI DE L S FL+RLFNTLSW MTEFSVS+RE+QEKY+ Sbjct: 992 VLFQRLLREACISDEGLFSSFLNRLFNTLSWTMTEFSVSVREMQEKYQ 1039 >ref|XP_003602474.1| RING finger and SPRY domain-containing protein [Medicago truncatula] gi|355491522|gb|AES72725.1| RING finger and SPRY domain-containing protein [Medicago truncatula] Length = 1301 Score = 79.7 bits (195), Expect = 2e-13 Identities = 36/48 (75%), Positives = 44/48 (91%) Frame = -3 Query: 145 VIFQKLLREACIQDEELLSVFLDRLFNTLSWAMTEFSVSIREIQEKYK 2 ++FQ+LL+EACI DE L S FL+RLFNTLSWAMTEFSVS+RE+QEKY+ Sbjct: 1020 ILFQRLLKEACINDEGLFSSFLNRLFNTLSWAMTEFSVSVREMQEKYQ 1067 >gb|AEL98841.1| zinc finger family protein, partial [Silene latifolia] gi|343172276|gb|AEL98842.1| zinc finger family protein, partial [Silene latifolia] Length = 290 Score = 77.4 bits (189), Expect = 1e-12 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = -3 Query: 145 VIFQKLLREACIQDEELLSVFLDRLFNTLSWAMTEFSVSIREIQEK 8 V+FQKLLR+AC DEEL FL+RLFNTLSW MTEFSVSIRE+QEK Sbjct: 59 VVFQKLLRDACADDEELFGAFLNRLFNTLSWTMTEFSVSIREMQEK 104 >ref|NP_850020.1| ubiquitination-promoting complex protein 1 [Arabidopsis thaliana] gi|300681232|sp|Q9SIZ8.2|RKP_ARATH RecName: Full=E3 ubiquitin-protein ligase RKP; Short=AtKPC1; AltName: Full=Protein RELATED TO KPC1 gi|330252157|gb|AEC07251.1| ubiquitination-promoting complex protein 1 [Arabidopsis thaliana] Length = 1280 Score = 77.0 bits (188), Expect = 1e-12 Identities = 35/47 (74%), Positives = 42/47 (89%) Frame = -3 Query: 142 IFQKLLREACIQDEELLSVFLDRLFNTLSWAMTEFSVSIREIQEKYK 2 +FQ LLR+ACI D ELLS FL+RLFNTLSW +TEFSVS+RE+QEKY+ Sbjct: 984 VFQALLRDACINDGELLSTFLNRLFNTLSWTITEFSVSVREMQEKYQ 1030