BLASTX nr result
ID: Panax21_contig00020613
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00020613 (440 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_196344.2| E3 ubiquitin-protein ligase XBAT33 [Arabidopsis... 55 8e-06 emb|CAB87283.1| putative protein [Arabidopsis thaliana] 55 8e-06 ref|XP_003633983.1| PREDICTED: uncharacterized protein LOC100255... 54 1e-05 emb|CBI40499.3| unnamed protein product [Vitis vinifera] 54 1e-05 >ref|NP_196344.2| E3 ubiquitin-protein ligase XBAT33 [Arabidopsis thaliana] gi|122239678|sp|Q4FE45.1|XB33_ARATH RecName: Full=E3 ubiquitin-protein ligase XBAT33; AltName: Full=Ankyrin repeat domain and RING finger-containing protein XBAT33; AltName: Full=Protein XB3 homolog 3 gi|70905089|gb|AAZ14070.1| At5g07270 [Arabidopsis thaliana] gi|117168057|gb|ABK32111.1| At5g07270 [Arabidopsis thaliana] gi|332003748|gb|AED91131.1| E3 ubiquitin-protein ligase XBAT33 [Arabidopsis thaliana] Length = 513 Score = 54.7 bits (130), Expect = 8e-06 Identities = 22/36 (61%), Positives = 27/36 (75%) Frame = +1 Query: 16 TISSDVFCPVTCSPFPSVGIPLCTCASPFILSSEIH 123 ++SSD+FCPVTCSPFPSV IP+CTC + E H Sbjct: 420 SVSSDIFCPVTCSPFPSVNIPMCTCNEGTCPNFETH 455 >emb|CAB87283.1| putative protein [Arabidopsis thaliana] Length = 519 Score = 54.7 bits (130), Expect = 8e-06 Identities = 22/36 (61%), Positives = 27/36 (75%) Frame = +1 Query: 16 TISSDVFCPVTCSPFPSVGIPLCTCASPFILSSEIH 123 ++SSD+FCPVTCSPFPSV IP+CTC + E H Sbjct: 426 SVSSDIFCPVTCSPFPSVNIPMCTCNEGTCPNFETH 461 >ref|XP_003633983.1| PREDICTED: uncharacterized protein LOC100255153 [Vitis vinifera] Length = 892 Score = 54.3 bits (129), Expect = 1e-05 Identities = 33/66 (50%), Positives = 39/66 (59%) Frame = -1 Query: 281 AYITPW*LMLTSESQEGKVTLTQPS*C*YYAKCRKRSEGASLVLEGRHNADKGWISELRM 102 AYITPW ++ T S Y RS+G +LVLEGRHNAD GWI+ELRM Sbjct: 111 AYITPWNNKGYDLAKSFNSKFTHLSPIWYDL----RSQGTNLVLEGRHNADIGWITELRM 166 Query: 101 KGEAQV 84 KG+A V Sbjct: 167 KGDAWV 172 >emb|CBI40499.3| unnamed protein product [Vitis vinifera] Length = 435 Score = 54.3 bits (129), Expect = 1e-05 Identities = 33/66 (50%), Positives = 39/66 (59%) Frame = -1 Query: 281 AYITPW*LMLTSESQEGKVTLTQPS*C*YYAKCRKRSEGASLVLEGRHNADKGWISELRM 102 AYITPW ++ T S Y RS+G +LVLEGRHNAD GWI+ELRM Sbjct: 111 AYITPWNNKGYDLAKSFNSKFTHLSPIWYDL----RSQGTNLVLEGRHNADIGWITELRM 166 Query: 101 KGEAQV 84 KG+A V Sbjct: 167 KGDAWV 172