BLASTX nr result
ID: Panax21_contig00020520
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00020520 (662 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFV15377.1| AGO1A [Solanum lycopersicum] gi|409893066|gb|AFV4... 100 2e-19 ref|XP_002526275.1| eukaryotic translation initiation factor 2c,... 100 2e-19 gb|ABC61503.1| AGO1-2, partial [Nicotiana benthamiana] 99 6e-19 ref|XP_002318338.1| argonaute protein group [Populus trichocarpa... 99 6e-19 gb|ABC61502.1| AGO1-1, partial [Nicotiana benthamiana] 99 7e-19 >gb|AFV15377.1| AGO1A [Solanum lycopersicum] gi|409893066|gb|AFV46190.1| argonaute1-1, partial [Solanum lycopersicum] Length = 1054 Score = 100 bits (249), Expect = 2e-19 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -2 Query: 142 LKYHETGREKDCLPQVGQWNMMNKKMVNGGIVNSWICINFARNVQDS 2 LKYH+TGREKDCLPQVGQWNMMNKKMVNGG VN+WICINF+RNVQDS Sbjct: 574 LKYHDTGREKDCLPQVGQWNMMNKKMVNGGTVNNWICINFSRNVQDS 620 >ref|XP_002526275.1| eukaryotic translation initiation factor 2c, putative [Ricinus communis] gi|223534406|gb|EEF36112.1| eukaryotic translation initiation factor 2c, putative [Ricinus communis] Length = 1063 Score = 100 bits (249), Expect = 2e-19 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -2 Query: 142 LKYHETGREKDCLPQVGQWNMMNKKMVNGGIVNSWICINFARNVQDS 2 LKYH+TGREKDCLPQVGQWNMMNKKMVNGG VN+WICINF+RNVQDS Sbjct: 582 LKYHDTGREKDCLPQVGQWNMMNKKMVNGGTVNNWICINFSRNVQDS 628 >gb|ABC61503.1| AGO1-2, partial [Nicotiana benthamiana] Length = 979 Score = 99.4 bits (246), Expect = 6e-19 Identities = 42/48 (87%), Positives = 46/48 (95%) Frame = -2 Query: 145 KLKYHETGREKDCLPQVGQWNMMNKKMVNGGIVNSWICINFARNVQDS 2 +LKYH+ GREKDCLPQVGQWNMMNKKMVNGG VN+WICINF+RNVQDS Sbjct: 497 RLKYHDNGREKDCLPQVGQWNMMNKKMVNGGTVNNWICINFSRNVQDS 544 >ref|XP_002318338.1| argonaute protein group [Populus trichocarpa] gi|222859011|gb|EEE96558.1| argonaute protein group [Populus trichocarpa] Length = 1062 Score = 99.4 bits (246), Expect = 6e-19 Identities = 42/47 (89%), Positives = 46/47 (97%) Frame = -2 Query: 142 LKYHETGREKDCLPQVGQWNMMNKKMVNGGIVNSWICINFARNVQDS 2 LKYH+TGREKDCLPQVGQWNMMNKKMVNGG VN+WIC+NF+RNVQDS Sbjct: 582 LKYHDTGREKDCLPQVGQWNMMNKKMVNGGRVNNWICVNFSRNVQDS 628 >gb|ABC61502.1| AGO1-1, partial [Nicotiana benthamiana] Length = 1052 Score = 99.0 bits (245), Expect = 7e-19 Identities = 41/47 (87%), Positives = 46/47 (97%) Frame = -2 Query: 142 LKYHETGREKDCLPQVGQWNMMNKKMVNGGIVNSWICINFARNVQDS 2 LKYH+TGREKDCLPQVGQWNMMNKKMVNGG VN+WIC+NF+RNVQD+ Sbjct: 572 LKYHDTGREKDCLPQVGQWNMMNKKMVNGGTVNNWICVNFSRNVQDT 618