BLASTX nr result
ID: Panax21_contig00020479
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00020479 (516 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001239046.1| calcineurin B-like 2 [Solanum lycopersicum] ... 117 1e-24 ref|XP_002864422.1| hypothetical protein ARALYDRAFT_918741 [Arab... 117 1e-24 ref|NP_200410.1| calcineurin B-like protein 2 [Arabidopsis thali... 117 1e-24 gb|AFK64728.1| calcineurin B-like protein 2 [Lilium longiflorum] 116 2e-24 ref|XP_002266438.2| PREDICTED: calcineurin B-like protein 03, pa... 115 3e-24 >ref|NP_001239046.1| calcineurin B-like 2 [Solanum lycopersicum] gi|353523404|dbj|BAL04562.1| calcineurin B-like molecule [Solanum lycopersicum] Length = 219 Score = 117 bits (293), Expect = 1e-24 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = +3 Query: 3 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT 170 TFEEADTKHDGKIDKEEWR+LVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT Sbjct: 164 TFEEADTKHDGKIDKEEWRNLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT 219 >ref|XP_002864422.1| hypothetical protein ARALYDRAFT_918741 [Arabidopsis lyrata subsp. lyrata] gi|297310257|gb|EFH40681.1| hypothetical protein ARALYDRAFT_918741 [Arabidopsis lyrata subsp. lyrata] Length = 226 Score = 117 bits (292), Expect = 1e-24 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = +3 Query: 3 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT 170 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHS+VEDT Sbjct: 171 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVEDT 226 >ref|NP_200410.1| calcineurin B-like protein 2 [Arabidopsis thaliana] gi|56748807|sp|Q8LAS7.2|CNBL2_ARATH RecName: Full=Calcineurin B-like protein 2; AltName: Full=SOS3-like calcium-binding protein 1 gi|168177188|pdb|2ZFD|A Chain A, The Crystal Structure Of Plant Specific Calcium Binding Protein Atcbl2 In Complex With The Regulatory Domain Of Atcipk14 gi|3309084|gb|AAC26009.1| calcineurin B-like protein 2 [Arabidopsis thaliana] gi|9758619|dbj|BAB09281.1| calcineurin B-like protein 2 [Arabidopsis thaliana] gi|15450407|gb|AAK96497.1| AT5g55990/MDA7_3 [Arabidopsis thaliana] gi|22655046|gb|AAM98114.1| At5g55990/MDA7_3 [Arabidopsis thaliana] gi|332009324|gb|AED96707.1| calcineurin B-like protein 2 [Arabidopsis thaliana] Length = 226 Score = 117 bits (292), Expect = 1e-24 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = +3 Query: 3 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT 170 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHS+VEDT Sbjct: 171 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVEDT 226 >gb|AFK64728.1| calcineurin B-like protein 2 [Lilium longiflorum] Length = 226 Score = 116 bits (291), Expect = 2e-24 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = +3 Query: 3 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT 170 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYL DITTTFPSFVFHSRVEDT Sbjct: 171 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLNDITTTFPSFVFHSRVEDT 226 >ref|XP_002266438.2| PREDICTED: calcineurin B-like protein 03, partial [Vitis vinifera] gi|296081444|emb|CBI18847.3| unnamed protein product [Vitis vinifera] Length = 184 Score = 115 bits (289), Expect = 3e-24 Identities = 54/56 (96%), Positives = 56/56 (100%) Frame = +3 Query: 3 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSRVEDT 170 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHS+V+DT Sbjct: 129 TFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT 184