BLASTX nr result
ID: Panax21_contig00020227
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00020227 (427 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002872391.1| hypothetical protein ARALYDRAFT_327088 [Arab... 94 2e-17 emb|CAB52557.1| putative protein [Arabidopsis thaliana] gi|72674... 93 2e-17 ref|NP_192575.3| global transcription factor group A2 [Arabidops... 93 2e-17 ref|XP_002313759.1| global transcription factor group [Populus t... 93 2e-17 ref|XP_002526173.1| suppressor of ty, putative [Ricinus communis... 92 3e-17 >ref|XP_002872391.1| hypothetical protein ARALYDRAFT_327088 [Arabidopsis lyrata subsp. lyrata] gi|297318228|gb|EFH48650.1| hypothetical protein ARALYDRAFT_327088 [Arabidopsis lyrata subsp. lyrata] Length = 1051 Score = 93.6 bits (231), Expect = 2e-17 Identities = 45/58 (77%), Positives = 51/58 (87%) Frame = -1 Query: 277 VKTACKGMRNIFTGSNIMFVPIKETTDVLAVESKAIELSRDTWVRMKIGTYKGDLAKV 104 VK A KGMRNI++ I+ VPI+E TDVL+VESKAI+LSRDTWVRMKIGTYKGDLAKV Sbjct: 234 VKEAIKGMRNIYSNQKILLVPIREMTDVLSVESKAIDLSRDTWVRMKIGTYKGDLAKV 291 >emb|CAB52557.1| putative protein [Arabidopsis thaliana] gi|7267476|emb|CAB77960.1| putative protein [Arabidopsis thaliana] Length = 1054 Score = 93.2 bits (230), Expect = 2e-17 Identities = 45/58 (77%), Positives = 50/58 (86%) Frame = -1 Query: 277 VKTACKGMRNIFTGSNIMFVPIKETTDVLAVESKAIELSRDTWVRMKIGTYKGDLAKV 104 VK A KGMRNI+ I+ VPI+E TDVL+VESKAI+LSRDTWVRMKIGTYKGDLAKV Sbjct: 237 VKEAIKGMRNIYANQKILLVPIREMTDVLSVESKAIDLSRDTWVRMKIGTYKGDLAKV 294 >ref|NP_192575.3| global transcription factor group A2 [Arabidopsis thaliana] gi|374095445|sp|Q9STN3.2|SPT51_ARATH RecName: Full=Putative transcription elongation factor SPT5 homolog 1 gi|332657229|gb|AEE82629.1| global transcription factor group A2 [Arabidopsis thaliana] Length = 1041 Score = 93.2 bits (230), Expect = 2e-17 Identities = 45/58 (77%), Positives = 50/58 (86%) Frame = -1 Query: 277 VKTACKGMRNIFTGSNIMFVPIKETTDVLAVESKAIELSRDTWVRMKIGTYKGDLAKV 104 VK A KGMRNI+ I+ VPI+E TDVL+VESKAI+LSRDTWVRMKIGTYKGDLAKV Sbjct: 237 VKEAIKGMRNIYANQKILLVPIREMTDVLSVESKAIDLSRDTWVRMKIGTYKGDLAKV 294 >ref|XP_002313759.1| global transcription factor group [Populus trichocarpa] gi|222850167|gb|EEE87714.1| global transcription factor group [Populus trichocarpa] Length = 1042 Score = 93.2 bits (230), Expect = 2e-17 Identities = 46/58 (79%), Positives = 51/58 (87%) Frame = -1 Query: 277 VKTACKGMRNIFTGSNIMFVPIKETTDVLAVESKAIELSRDTWVRMKIGTYKGDLAKV 104 V+ ACKG+RNIF G IM VPI+E TDVL+VESK I+LSRDTWVRMKIGTYKGDLAKV Sbjct: 242 VREACKGLRNIF-GQKIMLVPIREMTDVLSVESKVIDLSRDTWVRMKIGTYKGDLAKV 298 >ref|XP_002526173.1| suppressor of ty, putative [Ricinus communis] gi|223534550|gb|EEF36249.1| suppressor of ty, putative [Ricinus communis] Length = 1045 Score = 92.4 bits (228), Expect = 3e-17 Identities = 46/58 (79%), Positives = 51/58 (87%) Frame = -1 Query: 277 VKTACKGMRNIFTGSNIMFVPIKETTDVLAVESKAIELSRDTWVRMKIGTYKGDLAKV 104 V+ ACKG+RNI+ IM VPIKE TDVL+VESKAI+LSRDTWVRMKIGTYKGDLAKV Sbjct: 238 VREACKGLRNIYA-QKIMLVPIKEMTDVLSVESKAIDLSRDTWVRMKIGTYKGDLAKV 294