BLASTX nr result
ID: Panax21_contig00020102
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00020102 (442 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004144057.1| PREDICTED: DNA repair protein RAD51 homolog ... 64 2e-08 ref|XP_003551035.1| PREDICTED: DNA repair protein RAD51 homolog ... 64 2e-08 ref|XP_002449862.1| hypothetical protein SORBIDRAFT_05g024565 [S... 64 2e-08 ref|XP_002273803.1| PREDICTED: DNA repair protein RAD51 homolog ... 64 2e-08 ref|XP_002326313.1| predicted protein [Populus trichocarpa] gi|2... 64 2e-08 >ref|XP_004144057.1| PREDICTED: DNA repair protein RAD51 homolog [Cucumis sativus] gi|449518135|ref|XP_004166099.1| PREDICTED: DNA repair protein RAD51 homolog [Cucumis sativus] Length = 340 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +1 Query: 304 QRLLQIADRFGLNGADVLENVAYARAYKTDH 396 QRLLQIADRFGLNGADVLENVAYARAY TDH Sbjct: 170 QRLLQIADRFGLNGADVLENVAYARAYNTDH 200 >ref|XP_003551035.1| PREDICTED: DNA repair protein RAD51 homolog [Glycine max] Length = 343 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +1 Query: 304 QRLLQIADRFGLNGADVLENVAYARAYKTDH 396 QRLLQIADRFGLNGADVLENVAYARAY TDH Sbjct: 173 QRLLQIADRFGLNGADVLENVAYARAYNTDH 203 >ref|XP_002449862.1| hypothetical protein SORBIDRAFT_05g024565 [Sorghum bicolor] gi|241935705|gb|EES08850.1| hypothetical protein SORBIDRAFT_05g024565 [Sorghum bicolor] Length = 340 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +1 Query: 304 QRLLQIADRFGLNGADVLENVAYARAYKTDH 396 QRLLQIADRFGLNGADVLENVAYARAY TDH Sbjct: 167 QRLLQIADRFGLNGADVLENVAYARAYNTDH 197 >ref|XP_002273803.1| PREDICTED: DNA repair protein RAD51 homolog [Vitis vinifera] gi|297738498|emb|CBI27743.3| unnamed protein product [Vitis vinifera] Length = 337 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +1 Query: 304 QRLLQIADRFGLNGADVLENVAYARAYKTDH 396 QRLLQIADRFGLNGADVLENVAYARAY TDH Sbjct: 167 QRLLQIADRFGLNGADVLENVAYARAYNTDH 197 >ref|XP_002326313.1| predicted protein [Populus trichocarpa] gi|222833506|gb|EEE71983.1| predicted protein [Populus trichocarpa] Length = 348 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +1 Query: 304 QRLLQIADRFGLNGADVLENVAYARAYKTDH 396 QRLLQIADRFGLNGADVLENVAYARAY TDH Sbjct: 178 QRLLQIADRFGLNGADVLENVAYARAYNTDH 208