BLASTX nr result
ID: Panax21_contig00019435
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00019435 (783 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN78372.1| hypothetical protein VITISV_006585 [Vitis vinifera] 72 2e-10 ref|XP_002264125.1| PREDICTED: KH domain-containing protein At4g... 65 1e-08 ref|XP_003529764.1| PREDICTED: KH domain-containing protein At4g... 64 3e-08 ref|XP_003531758.1| PREDICTED: heterogeneous nuclear ribonucleop... 63 8e-08 ref|XP_004159029.1| PREDICTED: KH domain-containing protein At4g... 61 3e-07 >emb|CAN78372.1| hypothetical protein VITISV_006585 [Vitis vinifera] Length = 807 Score = 71.6 bits (174), Expect = 2e-10 Identities = 41/54 (75%), Positives = 45/54 (83%) Frame = +3 Query: 3 SLIGKGGSIIRALQNETGASIKITDAAAPDSNERVVLISAREACHSNTNTNTHH 164 SLIGKGGSIIR LQ+ETGASIKI D AAPDS+ERVV+ISAREAC + TN H Sbjct: 437 SLIGKGGSIIRXLQSETGASIKIAD-AAPDSDERVVVISAREAC-TLTNXEQKH 488 >ref|XP_002264125.1| PREDICTED: KH domain-containing protein At4g18375 [Vitis vinifera] gi|297735779|emb|CBI18466.3| unnamed protein product [Vitis vinifera] Length = 704 Score = 65.5 bits (158), Expect = 1e-08 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = +3 Query: 3 SLIGKGGSIIRALQNETGASIKITDAAAPDSNERVVLISARE 128 SLIGKGGSIIR LQ+ETGASIKI D AAPDS+ERVV+ISARE Sbjct: 341 SLIGKGGSIIRFLQSETGASIKIAD-AAPDSDERVVVISARE 381 >ref|XP_003529764.1| PREDICTED: KH domain-containing protein At4g18375-like [Glycine max] Length = 559 Score = 64.3 bits (155), Expect = 3e-08 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = +3 Query: 3 SLIGKGGSIIRALQNETGASIKITDAAAPDSNERVVLISARE 128 SLIGKGGS++RALQNETGASI+I + A PDS+ERVV+ISARE Sbjct: 207 SLIGKGGSVVRALQNETGASIQIVE-AGPDSDERVVVISARE 247 >ref|XP_003531758.1| PREDICTED: heterogeneous nuclear ribonucleoprotein K-like [Glycine max] Length = 565 Score = 62.8 bits (151), Expect = 8e-08 Identities = 32/42 (76%), Positives = 39/42 (92%) Frame = +3 Query: 3 SLIGKGGSIIRALQNETGASIKITDAAAPDSNERVVLISARE 128 SLIGKGGS++RALQNETGASI+I + A PDS+ERVV+ISA+E Sbjct: 213 SLIGKGGSVVRALQNETGASIQIVE-AGPDSDERVVVISAQE 253 >ref|XP_004159029.1| PREDICTED: KH domain-containing protein At4g18375-like [Cucumis sativus] Length = 716 Score = 60.8 bits (146), Expect = 3e-07 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = +3 Query: 3 SLIGKGGSIIRALQNETGASIKITDAAAPDSNERVVLISARE 128 SLIGKGG+++RALQNETGASIKI D PD +ER+V+ISARE Sbjct: 357 SLIGKGGTVVRALQNETGASIKIVD--TPDLDERLVVISARE 396