BLASTX nr result
ID: Panax21_contig00019322
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00019322 (484 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002319406.1| predicted protein [Populus trichocarpa] gi|2... 55 6e-06 ref|XP_004162715.1| PREDICTED: protein TIC110, chloroplastic-lik... 55 8e-06 ref|XP_004153267.1| PREDICTED: protein TIC110, chloroplastic-lik... 55 8e-06 ref|XP_004145231.1| PREDICTED: protein TIC110, chloroplastic-lik... 55 8e-06 >ref|XP_002319406.1| predicted protein [Populus trichocarpa] gi|222857782|gb|EEE95329.1| predicted protein [Populus trichocarpa] Length = 1011 Score = 55.1 bits (131), Expect = 6e-06 Identities = 29/42 (69%), Positives = 30/42 (71%) Frame = +3 Query: 3 PVPEKLSRLQCLLDIDDSTAEALQGMKDRALPNGTAEEEFVF 128 P PEKLSRLQ LL I DSTA AL MKDR P G EE+FVF Sbjct: 970 PAPEKLSRLQYLLGISDSTATALGEMKDRVPPVGAEEEKFVF 1011 >ref|XP_004162715.1| PREDICTED: protein TIC110, chloroplastic-like [Cucumis sativus] Length = 682 Score = 54.7 bits (130), Expect = 8e-06 Identities = 28/42 (66%), Positives = 30/42 (71%) Frame = +3 Query: 3 PVPEKLSRLQCLLDIDDSTAEALQGMKDRALPNGTAEEEFVF 128 P PEKLSRLQ LL IDDSTA A++ M DR P G EE FVF Sbjct: 641 PTPEKLSRLQYLLGIDDSTAAAIREMGDRLQPIGAEEENFVF 682 >ref|XP_004153267.1| PREDICTED: protein TIC110, chloroplastic-like [Cucumis sativus] Length = 596 Score = 54.7 bits (130), Expect = 8e-06 Identities = 28/42 (66%), Positives = 30/42 (71%) Frame = +3 Query: 3 PVPEKLSRLQCLLDIDDSTAEALQGMKDRALPNGTAEEEFVF 128 P PEKLSRLQ LL IDDSTA A++ M DR P G EE FVF Sbjct: 555 PTPEKLSRLQYLLGIDDSTAAAIREMGDRLQPIGAEEENFVF 596 >ref|XP_004145231.1| PREDICTED: protein TIC110, chloroplastic-like [Cucumis sativus] Length = 1014 Score = 54.7 bits (130), Expect = 8e-06 Identities = 28/42 (66%), Positives = 30/42 (71%) Frame = +3 Query: 3 PVPEKLSRLQCLLDIDDSTAEALQGMKDRALPNGTAEEEFVF 128 P PEKLSRLQ LL IDDSTA A++ M DR P G EE FVF Sbjct: 973 PTPEKLSRLQYLLGIDDSTAAAIREMGDRLQPIGAEEENFVF 1014