BLASTX nr result
ID: Panax21_contig00019225
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00019225 (546 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003549541.1| PREDICTED: probable cyclic nucleotide-gated ... 61 1e-07 ref|XP_003519149.1| PREDICTED: probable cyclic nucleotide-gated ... 60 2e-07 ref|XP_002529385.1| Cyclic nucleotide-gated ion channel, putativ... 60 3e-07 ref|XP_003610314.1| CNGC5-like protein [Medicago truncatula] gi|... 59 4e-07 ref|XP_002325129.1| predicted protein [Populus trichocarpa] gi|2... 58 8e-07 >ref|XP_003549541.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5-like [Glycine max] Length = 728 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = +3 Query: 426 MSISPMRLIIV*RFLQRSKGSDVLATKKALLFIILLQYIP 545 +S+ P+ I+V RFLQRSKGSDVLATK+ALLFIILLQY+P Sbjct: 206 LSVLPIPQIVVWRFLQRSKGSDVLATKQALLFIILLQYVP 245 >ref|XP_003519149.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5-like [Glycine max] Length = 728 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = +3 Query: 426 MSISPMRLIIV*RFLQRSKGSDVLATKKALLFIILLQYIP 545 +S+ P+ I+V RFLQRSKGSDVLATK+ALL+IILLQY+P Sbjct: 206 LSVLPIPQIVVWRFLQRSKGSDVLATKQALLYIILLQYVP 245 >ref|XP_002529385.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] gi|223531133|gb|EEF32981.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] Length = 735 Score = 59.7 bits (143), Expect = 3e-07 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = +3 Query: 426 MSISPMRLIIV*RFLQRSKGSDVLATKKALLFIILLQYIP 545 +S+ P+ I+V RFLQRS GSDVLATK+ALLFI+LLQYIP Sbjct: 209 LSVLPLPQIVVWRFLQRSNGSDVLATKQALLFIVLLQYIP 248 >ref|XP_003610314.1| CNGC5-like protein [Medicago truncatula] gi|355511369|gb|AES92511.1| CNGC5-like protein [Medicago truncatula] Length = 731 Score = 59.3 bits (142), Expect = 4e-07 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = +3 Query: 426 MSISPMRLIIV*RFLQRSKGSDVLATKKALLFIILLQYIP 545 +S+ P+ I+V RFLQRSK SDVLATK+ALLFIILLQYIP Sbjct: 208 LSVLPVPQIVVWRFLQRSKSSDVLATKQALLFIILLQYIP 247 >ref|XP_002325129.1| predicted protein [Populus trichocarpa] gi|222866563|gb|EEF03694.1| predicted protein [Populus trichocarpa] Length = 733 Score = 58.2 bits (139), Expect = 8e-07 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = +3 Query: 426 MSISPMRLIIV*RFLQRSKGSDVLATKKALLFIILLQYIP 545 +S+ P+ I+V RFL RSKGSDVLATK+ALL+IILLQYIP Sbjct: 208 LSVLPLPQIVVWRFLLRSKGSDVLATKQALLYIILLQYIP 247