BLASTX nr result
ID: Panax21_contig00019206
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00019206 (1126 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277373.1| PREDICTED: uncharacterized protein LOC100264... 72 4e-18 ref|XP_003534490.1| PREDICTED: DNA-directed RNA polymerase I sub... 65 3e-16 ref|NP_001236705.1| uncharacterized protein LOC100527229 [Glycin... 65 3e-16 ref|XP_002510510.1| conserved hypothetical protein [Ricinus comm... 62 9e-16 ref|XP_004147835.1| PREDICTED: DNA-directed RNA polymerase I sub... 61 2e-14 >ref|XP_002277373.1| PREDICTED: uncharacterized protein LOC100264366 [Vitis vinifera] gi|302142630|emb|CBI19833.3| unnamed protein product [Vitis vinifera] Length = 233 Score = 72.4 bits (176), Expect(2) = 4e-18 Identities = 36/52 (69%), Positives = 42/52 (80%), Gaps = 1/52 (1%) Frame = +3 Query: 513 RFNETFDGVVLAYDVNIIGDLAKILPGIHPYFGVRLTGK-LLFYPNPDIILE 665 +FNE FDGVVLAYDV+I AKILPGIHPYFGVRL K LLF P P++++E Sbjct: 37 KFNEIFDGVVLAYDVDIPSKDAKILPGIHPYFGVRLKAKLLLFSPKPNMLIE 88 Score = 46.2 bits (108), Expect(2) = 4e-18 Identities = 20/28 (71%), Positives = 25/28 (89%) Frame = +1 Query: 664 KHGKEVYVSRLHKQHKIKVGTIIRFIVK 747 KHG+ V+VSR HK+H IKVGT+IRF+VK Sbjct: 125 KHGEAVFVSRSHKRHVIKVGTMIRFLVK 152 >ref|XP_003534490.1| PREDICTED: DNA-directed RNA polymerase I subunit rpa43-like [Glycine max] Length = 232 Score = 65.5 bits (158), Expect(2) = 3e-16 Identities = 31/52 (59%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Frame = +3 Query: 513 RFNETFDGVVLAYDVNIIGDLAKILPGIHPYFGVRL-TGKLLFYPNPDIILE 665 +F+E F GVVLAYD+N + AKILPG+HPYFGV+L LLF P P+++LE Sbjct: 37 KFSEIFHGVVLAYDLNSLHTCAKILPGVHPYFGVKLKVNLLLFSPKPNMLLE 88 Score = 47.0 bits (110), Expect(2) = 3e-16 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = +1 Query: 664 KHGKEVYVSRLHKQHKIKVGTIIRFIVK 747 K G+EVY SR HKQH IKVGT+IRF+VK Sbjct: 125 KRGQEVYASRSHKQHVIKVGTMIRFLVK 152 >ref|NP_001236705.1| uncharacterized protein LOC100527229 [Glycine max] gi|255631830|gb|ACU16282.1| unknown [Glycine max] Length = 232 Score = 65.1 bits (157), Expect(2) = 3e-16 Identities = 32/51 (62%), Positives = 38/51 (74%), Gaps = 1/51 (1%) Frame = +3 Query: 516 FNETFDGVVLAYDVNIIGDLAKILPGIHPYFGVRL-TGKLLFYPNPDIILE 665 F+E FDGVVLAYDVN AKIL G+HPYFGV+L LLF P P+++LE Sbjct: 38 FSEIFDGVVLAYDVNSFDTCAKILSGVHPYFGVKLKVNLLLFSPKPNMLLE 88 Score = 47.0 bits (110), Expect(2) = 3e-16 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = +1 Query: 664 KHGKEVYVSRLHKQHKIKVGTIIRFIVK 747 K G+EVYVSR HK+H IKVGT+IRF+VK Sbjct: 125 KRGQEVYVSRSHKRHVIKVGTMIRFLVK 152 >ref|XP_002510510.1| conserved hypothetical protein [Ricinus communis] gi|223551211|gb|EEF52697.1| conserved hypothetical protein [Ricinus communis] Length = 229 Score = 62.4 bits (150), Expect(2) = 9e-16 Identities = 31/52 (59%), Positives = 37/52 (71%), Gaps = 1/52 (1%) Frame = +3 Query: 513 RFNETFDGVVLAYDVNIIGDLAKILPGIHPYFGVRLTGKLL-FYPNPDIILE 665 +FNE FDGVVLAY N A+IL G+HPYFGVRL +L F P PD++LE Sbjct: 37 KFNENFDGVVLAYAFNAPDKQARILCGVHPYFGVRLQATMLVFSPKPDMLLE 88 Score = 48.1 bits (113), Expect(2) = 9e-16 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = +1 Query: 664 KHGKEVYVSRLHKQHKIKVGTIIRFIVK 747 KHG+ +YVSR HKQH IKVGT+IRF+VK Sbjct: 125 KHGEALYVSRPHKQHVIKVGTMIRFVVK 152 >ref|XP_004147835.1| PREDICTED: DNA-directed RNA polymerase I subunit rpa43-like [Cucumis sativus] gi|449476884|ref|XP_004154864.1| PREDICTED: DNA-directed RNA polymerase I subunit rpa43-like [Cucumis sativus] Length = 231 Score = 61.2 bits (147), Expect(2) = 2e-14 Identities = 29/52 (55%), Positives = 39/52 (75%), Gaps = 1/52 (1%) Frame = +3 Query: 513 RFNETFDGVVLAYDVNIIGDLAKILPGIHPYFGVRLTGK-LLFYPNPDIILE 665 +F+E F+GV+LAY+ II AKIL G+HPYFGV + K LLF P P+++LE Sbjct: 37 KFDEKFEGVLLAYEAKIIDKNAKILSGVHPYFGVTIKAKLLLFSPKPNMLLE 88 Score = 44.7 bits (104), Expect(2) = 2e-14 Identities = 19/28 (67%), Positives = 24/28 (85%) Frame = +1 Query: 664 KHGKEVYVSRLHKQHKIKVGTIIRFIVK 747 KHG+E++VSR HK H IKVGT+IR +VK Sbjct: 125 KHGEEMFVSRAHKHHIIKVGTMIRLLVK 152