BLASTX nr result
ID: Panax21_contig00019095
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00019095 (440 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283273.1| PREDICTED: ATP-dependent zinc metalloproteas... 63 3e-08 >ref|XP_002283273.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial [Vitis vinifera] gi|297746048|emb|CBI16104.3| unnamed protein product [Vitis vinifera] Length = 820 Score = 62.8 bits (151), Expect = 3e-08 Identities = 39/78 (50%), Positives = 51/78 (65%), Gaps = 12/78 (15%) Frame = -2 Query: 199 MIFSRIGRSLSRST----KNLISNG---RSAFLGESLLGAP-----VSRLDGSLVSVRGY 56 MI SR+GRSLSRS+ +N++S G RSAFL E+L AP + +LDG L +RGY Sbjct: 1 MILSRLGRSLSRSSTAKPRNVLSGGNVGRSAFLNEALSRAPHYSTDLGQLDGGLGFLRGY 60 Query: 55 LAAIGANKNLASKLYLSD 2 L +IGA++ K YLSD Sbjct: 61 LTSIGASRGFVGKSYLSD 78