BLASTX nr result
ID: Panax21_contig00018784
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00018784 (368 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFC98464.1| leucine-rich repeat kinase-like protein [Atriplex... 59 5e-07 ref|XP_002509547.1| leucine-rich repeat protein, putative [Ricin... 56 3e-06 >gb|AFC98464.1| leucine-rich repeat kinase-like protein [Atriplex canescens] Length = 606 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +3 Query: 3 RPSFEDVLWNLQYAAQIQATTDGDQRFETVQQS 101 RPSFEDVLWNLQYAAQ+QAT DGDQ+F +V S Sbjct: 574 RPSFEDVLWNLQYAAQVQATADGDQKFGSVAYS 606 >ref|XP_002509547.1| leucine-rich repeat protein, putative [Ricinus communis] gi|223549446|gb|EEF50934.1| leucine-rich repeat protein, putative [Ricinus communis] Length = 769 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +3 Query: 3 RPSFEDVLWNLQYAAQIQATTDGDQRFETVQQS 101 RPSFEDVLWNLQYAAQ+QAT D DQ+ ++ QS Sbjct: 737 RPSFEDVLWNLQYAAQVQATADADQKSDSTSQS 769