BLASTX nr result
ID: Panax21_contig00018732
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00018732 (389 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519104.1| S-adenosylmethionine-dependent methyltransfe... 70 1e-10 ref|XP_002306079.1| predicted protein [Populus trichocarpa] gi|2... 70 2e-10 emb|CAB36713.1| putative protein [Arabidopsis thaliana] gi|72703... 69 5e-10 ref|XP_002869153.1| hypothetical protein ARALYDRAFT_491230 [Arab... 68 7e-10 ref|NP_195162.2| S-adenosyl-L-methionine-dependent methyltransfe... 68 7e-10 >ref|XP_002519104.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus communis] gi|223541767|gb|EEF43315.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus communis] Length = 250 Score = 70.5 bits (171), Expect = 1e-10 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = +1 Query: 280 VLELGCGNSQLCEELYKDGVTKLTCIDISAVAIEKM 387 VLELGCGNSQLCEE+YKDG+T +TCID+SAVA+EKM Sbjct: 60 VLELGCGNSQLCEEMYKDGITDITCIDLSAVAVEKM 95 >ref|XP_002306079.1| predicted protein [Populus trichocarpa] gi|222849043|gb|EEE86590.1| predicted protein [Populus trichocarpa] Length = 252 Score = 69.7 bits (169), Expect = 2e-10 Identities = 29/36 (80%), Positives = 36/36 (100%) Frame = +1 Query: 280 VLELGCGNSQLCEELYKDGVTKLTCIDISAVAIEKM 387 VLELGCGNSQLCEE+Y+DG+T++TCID+SAVA+EKM Sbjct: 57 VLELGCGNSQLCEEMYRDGITEVTCIDLSAVAVEKM 92 >emb|CAB36713.1| putative protein [Arabidopsis thaliana] gi|7270386|emb|CAB80153.1| putative protein [Arabidopsis thaliana] Length = 197 Score = 68.6 bits (166), Expect = 5e-10 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = +1 Query: 274 M*VLELGCGNSQLCEELYKDGVTKLTCIDISAVAIEKM 387 M VLELGCGNSQLCEELYKDG+ +TCID+S+VA+EKM Sbjct: 1 MKVLELGCGNSQLCEELYKDGIVDITCIDLSSVAVEKM 38 >ref|XP_002869153.1| hypothetical protein ARALYDRAFT_491230 [Arabidopsis lyrata subsp. lyrata] gi|297314989|gb|EFH45412.1| hypothetical protein ARALYDRAFT_491230 [Arabidopsis lyrata subsp. lyrata] Length = 248 Score = 68.2 bits (165), Expect = 7e-10 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +1 Query: 280 VLELGCGNSQLCEELYKDGVTKLTCIDISAVAIEKM 387 VLELGCGNSQLCEELYKDG+ +TCID+S+VA+EKM Sbjct: 54 VLELGCGNSQLCEELYKDGIVDITCIDLSSVAVEKM 89 >ref|NP_195162.2| S-adenosyl-L-methionine-dependent methyltransferase-like protein [Arabidopsis thaliana] gi|48310184|gb|AAT41770.1| At4g34360 [Arabidopsis thaliana] gi|50198934|gb|AAT70470.1| At4g34360 [Arabidopsis thaliana] gi|332660963|gb|AEE86363.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein [Arabidopsis thaliana] Length = 248 Score = 68.2 bits (165), Expect = 7e-10 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +1 Query: 280 VLELGCGNSQLCEELYKDGVTKLTCIDISAVAIEKM 387 VLELGCGNSQLCEELYKDG+ +TCID+S+VA+EKM Sbjct: 54 VLELGCGNSQLCEELYKDGIVDITCIDLSSVAVEKM 89