BLASTX nr result
ID: Panax21_contig00018728
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00018728 (630 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534335.1| RNA binding protein, putative [Ricinus commu... 95 1e-17 ref|XP_002320513.1| predicted protein [Populus trichocarpa] gi|2... 94 2e-17 ref|XP_002302838.1| predicted protein [Populus trichocarpa] gi|2... 93 3e-17 emb|CBI28414.3| unnamed protein product [Vitis vinifera] 90 3e-16 ref|XP_002270665.1| PREDICTED: zinc finger CCCH domain-containin... 90 3e-16 >ref|XP_002534335.1| RNA binding protein, putative [Ricinus communis] gi|223525472|gb|EEF28048.1| RNA binding protein, putative [Ricinus communis] Length = 578 Score = 94.7 bits (234), Expect = 1e-17 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = +3 Query: 3 CQQKRMFGFVTFVFAETVKQILAKGNPHFVCGARVLVKPYREKSRL 140 CQQKRMFGFVTF+F ETVKQILAKGNPH+VCGARVLVKPYREKSRL Sbjct: 386 CQQKRMFGFVTFIFVETVKQILAKGNPHYVCGARVLVKPYREKSRL 431 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = +1 Query: 448 LFFRKYPEKVQHPMYYGSHFVDAESELHSIPRVYDNSRMLRKQ 576 L RK+ EK+QHPMY SHF+D +SELH +P + DNSR+LRKQ Sbjct: 431 LIDRKFSEKLQHPMYNSSHFIDGDSELHPMPTISDNSRLLRKQ 473 >ref|XP_002320513.1| predicted protein [Populus trichocarpa] gi|222861286|gb|EEE98828.1| predicted protein [Populus trichocarpa] Length = 554 Score = 94.0 bits (232), Expect = 2e-17 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = +3 Query: 3 CQQKRMFGFVTFVFAETVKQILAKGNPHFVCGARVLVKPYREKSRL 140 CQQKRMFGFVTFVFAETVKQIL+KGNPH VCGARVLVKPYREKSRL Sbjct: 360 CQQKRMFGFVTFVFAETVKQILSKGNPHHVCGARVLVKPYREKSRL 405 Score = 69.3 bits (168), Expect = 5e-10 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = +1 Query: 457 RKYPEKVQHPMYYGSHFVDAESELHSIPRVYDNSRMLRKQ 576 RKY EK+QHP +Y HF+D +SELHS+PRV DNSR+LRKQ Sbjct: 408 RKYAEKIQHPFFYSQHFIDGDSELHSVPRVCDNSRLLRKQ 447 >ref|XP_002302838.1| predicted protein [Populus trichocarpa] gi|222844564|gb|EEE82111.1| predicted protein [Populus trichocarpa] Length = 391 Score = 93.2 bits (230), Expect = 3e-17 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = +3 Query: 3 CQQKRMFGFVTFVFAETVKQILAKGNPHFVCGARVLVKPYREKSRL 140 CQQKRMFGFVTFVFAETVK+ILAKGNPH +CGARVLVKPYREKSRL Sbjct: 343 CQQKRMFGFVTFVFAETVKKILAKGNPHHICGARVLVKPYREKSRL 388 >emb|CBI28414.3| unnamed protein product [Vitis vinifera] Length = 525 Score = 90.1 bits (222), Expect = 3e-16 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = +3 Query: 3 CQQKRMFGFVTFVFAETVKQILAKGNPHFVCGARVLVKPYREKS 134 CQQKRMFGFVTFVFAETVKQIL KGNPH++CGARVLVKPYREK+ Sbjct: 335 CQQKRMFGFVTFVFAETVKQILTKGNPHYICGARVLVKPYREKA 378 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +1 Query: 469 EKVQHPMYYGSHFVDAESELHSIPRVYDNSRMLRKQ 576 ++ QHPMYY HF+D +SEL SIPRV DNSR+LRKQ Sbjct: 384 DRRQHPMYYSPHFIDEDSELQSIPRVCDNSRLLRKQ 419 >ref|XP_002270665.1| PREDICTED: zinc finger CCCH domain-containing protein 18-like [Vitis vinifera] Length = 572 Score = 90.1 bits (222), Expect = 3e-16 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = +3 Query: 3 CQQKRMFGFVTFVFAETVKQILAKGNPHFVCGARVLVKPYREKS 134 CQQKRMFGFVTFVFAETVKQIL KGNPH++CGARVLVKPYREK+ Sbjct: 382 CQQKRMFGFVTFVFAETVKQILTKGNPHYICGARVLVKPYREKA 425 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +1 Query: 469 EKVQHPMYYGSHFVDAESELHSIPRVYDNSRMLRKQ 576 ++ QHPMYY HF+D +SEL SIPRV DNSR+LRKQ Sbjct: 431 DRRQHPMYYSPHFIDEDSELQSIPRVCDNSRLLRKQ 466