BLASTX nr result
ID: Panax21_contig00018553
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00018553 (555 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAB62555.1| potassium channel [Daucus carota] 140 2e-31 ref|XP_002308628.1| predicted protein [Populus trichocarpa] gi|2... 135 6e-30 ref|XP_003631831.1| PREDICTED: potassium channel KAT3-like [Viti... 132 5e-29 ref|XP_002324257.1| predicted protein [Populus trichocarpa] gi|2... 130 1e-28 ref|XP_002516596.1| Potassium channel KAT3, putative [Ricinus co... 130 2e-28 >emb|CAB62555.1| potassium channel [Daucus carota] Length = 629 Score = 140 bits (352), Expect = 2e-31 Identities = 69/83 (83%), Positives = 77/83 (92%) Frame = -2 Query: 554 QMLAHMQFKFKTAKLQQEEVLEDLPKAIRSSIAQYLFYKIIENTYLFKDVSEDFIRLMVS 375 QMLAHMQ KFKTA+LQQEEVLEDLPKAIRSSIAQ+LF+K IENTYLF+DVS+D I +VS Sbjct: 334 QMLAHMQLKFKTAELQQEEVLEDLPKAIRSSIAQHLFHKTIENTYLFRDVSDDLISQLVS 393 Query: 374 EMKAEYFPPKVEIILQNEIPSQF 306 E+KAEYFPPKVEIILQNEIP+ F Sbjct: 394 EIKAEYFPPKVEIILQNEIPTDF 416 >ref|XP_002308628.1| predicted protein [Populus trichocarpa] gi|222854604|gb|EEE92151.1| predicted protein [Populus trichocarpa] Length = 586 Score = 135 bits (339), Expect = 6e-30 Identities = 67/83 (80%), Positives = 75/83 (90%) Frame = -2 Query: 554 QMLAHMQFKFKTAKLQQEEVLEDLPKAIRSSIAQYLFYKIIENTYLFKDVSEDFIRLMVS 375 QMLAHMQ KFKTA+LQQEEVLE+LPKAIRSSIAQ+LF+ I+ TYLFK VSED I +VS Sbjct: 334 QMLAHMQLKFKTAELQQEEVLENLPKAIRSSIAQHLFHSIVAKTYLFKGVSEDLITQLVS 393 Query: 374 EMKAEYFPPKVEIILQNEIPSQF 306 EMKAEYFPPKVEIILQNEIP++F Sbjct: 394 EMKAEYFPPKVEIILQNEIPTEF 416 >ref|XP_003631831.1| PREDICTED: potassium channel KAT3-like [Vitis vinifera] gi|296081948|emb|CBI20953.3| unnamed protein product [Vitis vinifera] Length = 631 Score = 132 bits (331), Expect = 5e-29 Identities = 63/83 (75%), Positives = 74/83 (89%) Frame = -2 Query: 554 QMLAHMQFKFKTAKLQQEEVLEDLPKAIRSSIAQYLFYKIIENTYLFKDVSEDFIRLMVS 375 QMLAHMQ KFKTA+LQQEEVLEDLPKAIRSSIAQ+LF+K +E YLFK +S+D + +VS Sbjct: 333 QMLAHMQLKFKTAELQQEEVLEDLPKAIRSSIAQHLFHKTVEKAYLFKGISDDLVTQLVS 392 Query: 374 EMKAEYFPPKVEIILQNEIPSQF 306 E+KAEYFPPKV+IILQNEIP+ F Sbjct: 393 EIKAEYFPPKVDIILQNEIPTDF 415 >ref|XP_002324257.1| predicted protein [Populus trichocarpa] gi|222865691|gb|EEF02822.1| predicted protein [Populus trichocarpa] Length = 633 Score = 130 bits (327), Expect = 1e-28 Identities = 63/83 (75%), Positives = 75/83 (90%) Frame = -2 Query: 554 QMLAHMQFKFKTAKLQQEEVLEDLPKAIRSSIAQYLFYKIIENTYLFKDVSEDFIRLMVS 375 QMLAHMQ KFKTA+LQQEEVLEDLPKAIR+SIA +LF+ ++ +TYLFK VSED + +V+ Sbjct: 335 QMLAHMQLKFKTAELQQEEVLEDLPKAIRTSIALHLFHGVVASTYLFKGVSEDLLTQLVT 394 Query: 374 EMKAEYFPPKVEIILQNEIPSQF 306 EMKAEYFPPKVEIILQNEIP++F Sbjct: 395 EMKAEYFPPKVEIILQNEIPTEF 417 >ref|XP_002516596.1| Potassium channel KAT3, putative [Ricinus communis] gi|223544416|gb|EEF45937.1| Potassium channel KAT3, putative [Ricinus communis] Length = 629 Score = 130 bits (326), Expect = 2e-28 Identities = 65/83 (78%), Positives = 71/83 (85%) Frame = -2 Query: 554 QMLAHMQFKFKTAKLQQEEVLEDLPKAIRSSIAQYLFYKIIENTYLFKDVSEDFIRLMVS 375 QMLAHMQ KFKTA+LQQEEVLEDLPKAIRSSI+Q+LF +EN YL K VSED I MVS Sbjct: 332 QMLAHMQLKFKTAELQQEEVLEDLPKAIRSSISQHLFRNTVENAYLVKGVSEDLITQMVS 391 Query: 374 EMKAEYFPPKVEIILQNEIPSQF 306 EMKAEY+PPKVEIILQNE P+ F Sbjct: 392 EMKAEYYPPKVEIILQNEFPTDF 414